Conserved Protein Domain Family
Caldesmon

?
pfam02029: Caldesmon 
Caldesmon
Statistics
?
Aligned: 16 rows
Threshold Bit Score: 255.601
Threshold Setting Gi: 512828875
Created: 30-Apr-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_015193718  28 E-DEEEIARERRRRA-------------REAFRS-QTSSMGGLVSEDGQPAEHS------QYDSELKSSGQEGLEEDEGF 86  spotted gar
6_pfamImport   1 DdDEEEAARERRRRA-------------RQERLR-QKQEEEALGQVTDQVEVNAqnsvpaEEAKTTTPNTQGEGDDEAAL 66 
BAA04538      23 DdDEEEAARERRRRA-------------RQERLR-QKEEGDVSGEVTEKSEVNAqnsvaeEETKR-------STDDEAAL 81  chicken
XP_014346545  31 DdDEEEAARERRRRA-------------RQERMRlQKEEEESTSQVTEKIEVNSqnsvaeEETKTITATTAATTDDEVAF 97  coelacanth
XP_022527858  28 E-DAEEIERERRRRA-------------RESLRK-ERS----LTGSSGSPQDGSgpteecLYHSGLKPSSPGGLEEDEGF 88  Mexican tetra
XP_003201508  28 E-DAEEIERERRRRA-------------REAFRN-QHS----LSGSAGSPQDSAnppeasLFESELKPSSPVALDEDEGF 88  zebrafish
XP_015193719  28 E-DEEEIARERRRRA-------------REAFRS-QTSSMGGLVSEDGQPAEHS------QYDSELKSSGQEGLEEDEGF 86  spotted gar
XP_011975603 295 eaeEKAAAQERERRE-------------AEERER-IKEEERKAEE--ERQRIKEqerkaeEERQRVKEQERKAEEERQRV 358 mouflon
XP_009001272 296 eaeEKAAAQERERREeerermreeekraAEERER-MREEEKRAAE--ERQRVKEeekraaEERQRVKEEEKRAAEERQRV 372 white-tufted-ea...
XP_004912850 291 heaeriatvererheteriaieererheaeakqeaeqrekeqaeaeerkrqrqqeeeekklaeeraeaerkaqeerervl 370 tropical clawed...
XP_015193718  87 SDWTQKLERRRQKRLEEqcQgaGERvps------------------taPTPESWRETEEREGelqcgdwerkasdgrvlg 148 spotted gar
6_pfamImport  67 LERLARREERRQKRLQE--A--LERqkefdptitda--glslpsrrmeNNTAENETAEKEEK------------------ 122
BAA04538      82 LERLARREERRQKRLQE--A--LERqkefdptitdg--slsvpsrrevNNVEENEITGKEEK------------------ 137 chicken
XP_014346545  98 LERMARREERRQKRLQE--A--LERqkefdptit-----dekvsvprrNEQEENENVAKEEK------------------ 150 coelacanth
XP_022527858  89 SDWTQRLERDRRARQEEngPreEDLevertmngatkredkisssvltrPLKAQYQVEEEEEY------------------ 150 Mexican tetra
XP_003201508  89 SDWTQKLERRTRLKMEEtaNgeKLQeekknvntrpkqiekssftssveHHQTQDREGEDKRS------------------ 150 zebrafish
XP_015193719  87 SDWTQKLERRRQKRLEEqcQgaGERvps------------------taPTPESWRETEEREGelqcgdwerkasdgrvlg 148 spotted gar
XP_011975603 359 KEQERKAEEERQRAKAE--E--EERakiee--------------qkrkKQLEEKRGQMQEKK------------------ 402 mouflon
XP_009001272 373 KEEEKRAAEERQRAKAE--E--EEKaktee--------------qkrnKQLEEKKNATQETK------------------ 416 white-tufted-ea...
XP_004912850 371 aeqkkaeeeklrleaeqrkaaeeeklrleaeqrkaaeekkkaeeeklrleaeqrkaaqekkkaeekrleeererkkadek 450 tropical clawed...
XP_015193718 149 dahgsgegAGRRREREdherpwKDEERQAADKGKEKDDK------------------------VKENKKELKvt------ 198 spotted gar
6_pfamImport 123 --------SESRQERY------EIEETEIITKSYQKNDWrdaqk--------------meeeeRKRAEAERVrggkwane 174
BAA04538     138 --------VETRQGRC------EIEETETVTKSYQRNNWrqdgee-------------egkkeEKDSEEEKPkevpteen 190 chicken
XP_014346545 151 --------VDTRYDRY------EVEETEP--KEYERNNWkekevekevekeeekeeeeeeveeEEEVEEEKPepnyiaee 214 coelacanth
XP_022527858 151 --------QPVKKSSVkr---mQFGERQSSFKDKEAEEWkeevtrinkrq----eedprphaeekVKRQEVKvs------ 209 Mexican tetra
XP_003201508 151 --------DSITKKPM------EISERLYSQRAEERLDHskrrqpei---------kpptenkAKEERKEVKvs------ 201 zebrafish
XP_015193719 149 dahgsgegAGRRREREdherpwKDEERQAADKGKEKDDK------------------------VKENKKELKvt------ 198 spotted gar
XP_011975603 403 --------IKGEKVEE------KTAGKGVSEKKVQEDKPhtavpkkqee-----ergakvpakREKSQEDKAafkkeelk 463 mouflon
XP_009001272 417 --------IKGEKVKV------KIEGKWVNEKKVQEDKLqtavpkkq---------geekgakREKLQEDKPtfkkeeik 473 white-tufted-ea...
XP_004912850 451 kaaeererkkaeekkaaedrerkkaeeekarleakkkeekkdkkekiqpaflrkqgedkeakvdsrkdkisnekpragfr 530 tropical clawed...
XP_015193718 199 -------------ykSKVFLQQEVRHINSNGA-AaeEEvtsHLVQTKRMQ-RSLSQS---------QEAEEEQEVFLETE 254 spotted gar
6_pfamImport 175 kvkdekikkdkepkeVKSILDRKKGFTEVKTQnG--EF---MTHKLKHTE-NTFRPTnrsggrpsrRPRRPKAASQVEAG 248
BAA04538     191 qvkdnkdkekapkeeMKSVWDRKRGVPEQKAQnGerEL---TTPKLKSTE-NAF------------GRSNLKGAANAEAG 254 chicken
XP_014346545 215 ikeekvveeykekviEKKVEDHKKVIPEPKPQnGe-DFhveTTYKHKRPE-RTLSMKsn------pDTDEAEVEVRIEAE 286 coelacanth
XP_022527858 210 -------------ytSKVFLQHD-RMPSANNEdTagEEvtsQLFKTKKTVsRNTGQT---------SEPREPAEGNLETE 266 Mexican tetra
XP_003201508 202 -------------ytSKVFLQQE-RIPNGKAE-AapEEvtpNPVKTKRSP-SRIVDTnq------vFETKKDTHAVLETE 259 zebrafish
XP_015193719 199 -------------ykSKVFLQQEVRHINSNGA-AaeEEvtsHLVQTKRMQ-RSLSQS---------QEAEEEQEVFLETE 254 spotted gar
XP_011975603 464 de---ktkkdkeskdVKSFLDAKKGFTEVKSQnG--EF---MTHKLKHTE-NTFsrag----grvsEAKEAEGTSQVEAG 530 mouflon
XP_009001272 474 dek--ikkdkepkeeVKSFMDRKKGFTEVKSQnG--EF---MTHKLKHTE-NTFsrpgg---kasvDTKEAEGAPQVEAG 542 white-tufted-ea...
XP_004912850 531 keevkeekakgqkedLKATWERKKEIPDIKAQnGe-SGherAPQKLKQLE-KFGgtk------slpTSDETDSVSKVEAD 602 tropical clawed...
XP_015193718 255 QKLEKIRRSHQEKESQEFEQLRQKQLEAEAEleelNRRREQRRRLREEEEQRRGQEEHQRQlRGEEERRRMKEEIEKRRM 334 spotted gar
6_pfamImport 249 QRLEELRRRRAKSERRDYKRLHGSLRKSSIEvvhlGPSSKRDRGVYEYSRLGMRAQRDDPQ-STEEEKRRLKEEIERRRA 327
BAA04538     255 S-----------------EKLKEKQQEAAVEldelKKRREERRKILEEEEQKKKQEEAERKiREEEEKKRMKEEIERRRA 317 chicken
XP_014346545 287 KKLEELRRRRDELETEEFEKLKQKQQEAAVEleelKKKREERRKILEEEEQKRKQEEAEKKkKEEEEKRRMKEEIERRRA 366 coelacanth
XP_022527858 267 QKLEKIRRSHQEKESQELEHLRLRQAEAEVEleelKRKREERRRVREEEERRREEEEHLRLvKEEDEKRQMKEDIERRRM 346 Mexican tetra
XP_003201508 260 LKLEKIRRSHQEKENQEMENLRQRQAEAELEleelKKKREERRKTREEEERRREEEEQLKQtKKEEDKRQMKEDIERRRM 339 zebrafish
XP_015193719 255 QKLEKIRRSHQEKESQEFEQLRQKQLEAEAEleelNRRREQRRRLREEEEQRRGQEEHQRQlRGEEERRRMKEEIEKRRM 334 spotted gar
XP_011975603 531 KRLEELRRRRGETESEEFEKLKQKQQEAALEleelKKKREERRKVLEEEEQRKKQEEAERKvREEEEKRRLKEEIERRRA 610 mouflon
XP_009001272 543 KRLEELRRRRGETESEEFEKLKQKQQEAALEleelKKKREERRKVLEEEEQRRKQEEADRKlREEEEKRRLKEEIERRRA 622 white-tufted-ea...
XP_004912850 603 KRLEELRRRRGENESGEFDKLKQKQQEAAVEleglKKRREERRKILEEEEQKKKQEEAERKaKEEEEKKRLKEDIEKRRA 682 tropical clawed...
XP_015193718 335 EAAEKRLKH-LSTSsAEGEePFSPLTPKSPTFKneseervtaentysITERTE-SLNRSLKKsNSVKKTQpPVPISKIDD 412 spotted gar
6_pfamImport 328 EAAEKRQKMpEDSV-SDDKkPFKCFTPKGSSLK--------------IEERAE-FLNKSVQK-SGVKSTHqAAVVSKIDS 390
BAA04538     318 EAAEKRQKVpEDGV-SEEKkPFKCFSPKGSSLK--------------IEERAE-FLNKSAQK-SGMKPAHtTAVVSKIDS 380 chicken
XP_014346545 367 EAAEKRQKLpEDGSeTDEKkPFKCVSPRGSSLK--------------IGERAE-FLNKSVQKsSSVKSSHpTAVVSKIDS 431 coelacanth
XP_022527858 347 EAAEKRMKN-LSTSsPDKDdSFNPLSPKSHTNK--------------ITE-RTeSLNRSLKKsNSFKKTQpPVLLSKIDD 410 Mexican tetra
XP_003201508 340 EAVEKRMKN-INVSpTDGDdPFNPLNPMSPTFK--------------ITERTE-SLNRSLKKsNSFKKTQrPVLLPKIDD 403 zebrafish
XP_015193719 335 EAAEKRLKH-LSTSsAEGEePFSPLTPKSPTFK--------------ITERTE-SLNRSLKKsNSVKKTQpPVPISKIDD 398 spotted gar
XP_011975603 611 EAAEKRQKMpEDGL-SEDKkPFKCFTPKGSSLK--------------IEERAE-FLNKSVQK-SGVKSTHqAAVVSKIDS 673 mouflon
XP_009001272 623 EAAEKRQKMpEDGL-SDDKkPFKCFTPKGSSLK--------------IEERAE-FLNKSVQKsSGVKSTHqAAVVSKIDS 686 white-tufted-ea...
XP_004912850 683 EAAEKRQKLpEDGL-TEEKkPFKCFTPKGSSLK--------------IEERAE-FLNKSAQKg-STKSTQpAAPVSKIDS 745 tropical clawed...
XP_015193718 413 RLELYTHAIeSSTKETRAAKQAVVDIPSPSE--PISSKKSLFEA-EAWSQSSAKGTPSKDTEGLKVGVADLITQWVKGTD 489 spotted gar
6_pfamImport 391 RLEQYTSAI-EGTKSAKPTKPAASDLPVPAE--GVRNIKTMWEKgKVFSSPTASGTPNKETAGLKVGVSSRINEWLTKTP 467
BAA04538     381 RLEQYTSAV-VGNKAAKPAKPAASDLPVPAE--GVRNIKSMWEKgNVFSSPGGTGTPNKETAGLKVGVSSRINEWLTKTP 457 chicken
XP_014346545 432 RLEQYNSAI-ESTKAAKPVKPAAADLPVPAEgvGVRNIKSMWEKgNVFGSPGNPSTPNKETAGLKVGVSNRINEWLNKTP 510 coelacanth
XP_022527858 411 RLEQYTHAVeISAKEPKTVKAAAVDMPSVPE--PVTAKKNLFEAgEAWNQTTFKGTPSKDTEGLKVAVAERITQWVKGSP 488 Mexican tetra
XP_003201508 404 KLEQYTHAIeISSKEAKTLKSAAVDMPCVSA--PVASKKTLFEGgEVWSQTSLKGMPSKDADCVKVGVANLINHWVKGSP 481 zebrafish
XP_015193719 399 RLELYTHAIeSSTKETRAAKQAVVDIPSPSE--PISSKKSLFEA-EAWSQSSAKGTPSKDTEGLKVGVADLITQWVKGTD 475 spotted gar
XP_011975603 674 RLEQYTSAI-EGTKAAKPTKPAASDLPVPAE--GVRNIKSMWEKgNVFSSPTASGTPNKETAGLKVGVSSRINEWLTKTP 750 mouflon
XP_009001272 687 RLEQYTSAI-EGTKSAKPTKPAASDLPVPAE--GVRNIKSMWEKgNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTP 763 white-tufted-ea...
XP_004912850 746 RLEQYTSAI-GSNKGAKPAKTAPSDLPLAAD--GVRNIKSMWEKgNVFSSPGGALSPNKETATIKVGVSSRINEWLTKTP 822 tropical clawed...
XP_015193718 490 DcSTKNSPSKPADFKVGDVLHKKSLWE 516 spotted gar
6_pfamImport 468 D-GSKSPAPKPSDLRPGDVSGKRNLWE 493
BAA04538     458 E-GNKSPAPKPSDLRPGDVSGKRNLWE 483 chicken
XP_014346545 511 E-SNKATAAKPSDLRPGDVSNKRNLWE 536 coelacanth
XP_022527858 489 EsGNKNMPSKPSDVKAGDVLQKKNMWE 515 Mexican tetra
XP_003201508 482 EgGNRHSPSAPSDVKSGGVMRKKNMWE 508 zebrafish
XP_015193719 476 DcSTKNSPSKPADFKVGDVLHKKSLWE 502 spotted gar
XP_011975603 751 E-GSKSPAPKPSDLRPGDVSGKRNLWE 776 mouflon
XP_009001272 764 D-GNKSPAPKPSDLRPGDVSGKRNLWE 789 white-tufted-ear marmoset
XP_004912850 823 E-TNKTTPSKPSDLRPGDVSGKRNLWE 848 tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap