Conserved Protein Domain Family
TRM

?
pfam02005: TRM 
N2,N2-dimethylguanosine tRNA methyltransferase
This enzyme EC:2.1.1.32 used S-AdoMet to methylate tRNA. The TRM1 gene of Saccharomyces cerevisiae is necessary for the N2,N2-dimethylguanosine modification of both mitochondrial and cytoplasmic tRNAs. The enzyme is found in both eukaryotes and archaebacteria
Statistics
?
Aligned: 9 rows
Threshold Bit Score: 457.615
Threshold Setting Gi: 12230740
Created: 19-Mar-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P15565  33 GAPRINIEDFN-IVkegkaeilFPKKETVFYNPIQQFNRDLSVTCI----KaWDNLYGEECGQKrnnkkskkkrcaetnd 107 Saccharomyces cerevis...
Q9P804  27 GASASLTEGSA-IIp-------FSNPNEVFYNPVQQFNRDLSVTAI----RaWSETRSKKIVAKshhrhqlldqnselsq 94  Schizosaccharomyces p...
Q9NXH9  45 GEERPREVQETtVTegaa-kiaFPSANEVFYNPVQEFNRDLTCAVItefaRiQLGAKGIQIKVPgekdtqkvvvdlseqe 123 human
Q23270   9 GDSAIKSEDKEeVTviqegqakVGFHGPVFYNPVQEFNRDLTVTVL----R-QFSADHQKWAEEqkqlkteeeppk---- 79  Caenorhabditis elegans
O27258   7 GSVTIRVPDF--SK--------VSARAPVFYNPAMEFNRDVSVVA--------LQVFQRLLGGE---------------- 52  Methanothermobacter t...
O67010   7 GIAKIIVPEIP-KT--------VSSDMPVFYNPRMRVNRDLAVLG--------LEYLCKKLGRP---------------- 53  Aquifex aeolicus VF5
O29443   6 GRARVKVEG-------------------VFYNPRMRFCRDLDMLV--------FATMDSK-------------------- 38  Archaeoglobus fulgidu...
Q58356   6 GEVVFEVPDK--LT--------VTKKDEVFYNPRMKTCRDISIAVI----QaFLNLYHKRD--K---------------- 53  Methanocaldococcus ja...
P81554  11 GKAKVLVPKA--KT--------IYD-SPVFYNPRMAPNRDVVVLL--------LNVLKPK-------------------- 51  Pyrococcus furiosus D...
P15565 108 dsskr----qkmgngspkeavgnsnrnepyINILEALSATGLRAIRYA--HEIPHVREVIANDLLPEAVESIKRN----- 176 Saccharomyces cerevis...
Q9P804  95 enltkcdtthdfekncsektdstsadniagFTILEALSATGLRSIRYA--KELPNVKRILANDLLENAVKTIEKN----- 167 Schizosaccharomyces p...
Q9NXH9 124 eekvelkesenlasgdqprtaavgeiceegLHVLEGLAASGLRSIRFA--LEVPGLRSVVANDASTRAVDLIRRN----- 196 human
Q23270  80 ------------------kknklainedgkIRILDALSASGLRALRFS--KEVPNVGFIMANDFSDNAVASIQEN----- 134 Caenorhabditis elegans
O27258  53 ------------------------------ISVADTFSGSGIRAIRYL--VEVEGVSEAFANDINPLAVECIKNN----- 95  Methanothermobacter t...
O67010  54 ------------------------------VKVADPLSASGIRAIRFL--LETSCVEKAYANDISSKAIEIMKEN----- 96  Aquifex aeolicus VF5
O29443  39 -------------------------------EYFDALSASGIRGIRAA--LE-AGKKAVF-NDVSPKAVKVIEEN----- 78  Archaeoglobus fulgidu...
Q58356  54 ------------------------------FYIADALAGSGIRGLRYAkeLEFNGELKVFLNDINPKAYEKIINN----- 98  Methanocaldococcus ja...
P81554  52 -------------------------------IVLDALSATGIRGIRFA--LE-TPAEEIWMNDINELAYELMKKNvllnf 97  Pyrococcus furiosus D...
P15565 177 -VEYNSVEn--------IVKPNLDDANVLMYrnkATNNKFHVIDLDPYGTVTPFVDAAIQSIEEG-GLMLVTCTDLSVLA 246 Saccharomyces cerevis...
Q9P804 168 -VNYNNVSd--------IVIPNKGDANAVMH---MNKFHYDVIDLDPYGSAAPFLDAAVQSVSKD-GLLCITCTDSAVLA 234 Schizosaccharomyces p...
Q9NXH9 197 -VQLNDVAh--------LVQPSQADARMLMYqhqRVSERFDVIDLDPYGSPATFLDAAVQAVSEG-GLLCVTCTDMAVLA 266 human
Q23270 135 -VKLNGVEd--------IVEAHFGDAVMTMMehrGIDKRFHAVDLDPYGTASTFLDSAVQCVADR-GILMVTCTDMAVLC 204 Caenorhabditis elegans
O27258  96 -SVINSVSp---------eVSRE-DASIFLR---SNHGRFDVIDIDPFGTPAPFMDSAAASARNN-SLLAVTATDTSSLC 160 Methanothermobacter t...
O67010  97 -FKLNNIPe-------dRYEIHGMEANFFLRk--EWGFGFDYVDLDPFGTPVPFIESVALSMKRG-GILSLTATDTAPLS 165 Aquifex aeolicus VF5
O29443  79 ---LRENGvs-------geVING-DAAAVM-----RQRAFEHIDIDPFGSPAPFMDSACFSAKR---YLSVTATDTAALC 139 Archaeoglobus fulgidu...
Q58356  99 -AKLNEIEni--------dVFNE-DANTFLS---KHFRFFNVVDIDPFGSPAPYVEQAIRALVTRnGLLCLTATDTAALC 165 Methanocaldococcus ja...
P81554  98 kGTLKENAkraifegekTIVINNDDANRLMA---EKHRYFHFIDLDPFGSPMEFLDTALRSVKRK-GILGVTATDGAPLC 173 Pyrococcus furiosus D...
P15565 247 GnGYPEKCFALYGgANMVSHESTHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVKVKTSPIEVKNVMSSTMT 326 Saccharomyces cerevis...
Q9P804 235 GnAYPEKCFSNYG-GSSLRSNFCHEQAVRHLLYAIAASAAKYGRAIKPLLSLSIDFYFRVFVQIKAKPVLVKNLQSQSLL 313 Schizosaccharomyces p...
Q9NXH9 267 G-NSGETCYSKYG-AMALKSRACHEMALRIVLHSLDLRANCYQRFVVPLLSISADFYVRVFVRVFTGQAKVKASASKQAL 344 human
Q23270 205 G-NTPEACYNKYD-AVTTRMKCCHEVGLRILLRAIDSAANRYTRYIEPLVSISVDFYVRVFVRVHTGAFQAKQSGTKVGT 282 Caenorhabditis elegans
O27258 161 G-TYIKPCLRKYS-SRPLKTEYCHETGLRILAGFTAMNLARYRKAASVLLSHSSQHYMRLYIRVRRGARRADESIRNIGF 238 Methanothermobacter t...
O67010 166 G-TYPKTCMRRYM-ARPLRNEFKHEVGIRILIKKVIELAAQYDIAMIPIFAYSHLHYFKLFFVKERGVEKVDKLIEQFGY 243 Aquifex aeolicus VF5
O29443 140 G-SATNSGLKKYG-AFAVKTDVYHEVGLRMLIGFVVREATKYEKALFPLISWVREHYYRVHFKIKKSTAMSAKVYEKMGY 217 Archaeoglobus fulgidu...
Q58356 166 G-RSKKSCLRKYL-AYPLFGRDCHEFALRVLVGYVMRMATKYELALKPVFCHATDHYVRVYLVTDRGAKRADKVFEMLGY 243 Methanocaldococcus ja...
P81554 174 G-AHPKACLRKYL-AVPLRGELCHEVGTRILVGVIARYAAKYDLGMEVLLAYYKDHYFRAFVKLKDGAKKGDETLENLGY 251 Pyrococcus furiosus D...
P15565 327 TYHCSRCgsyhnqplgrISQregRNNKTFTKYSvaqgppvdTKCKFCEGTYHLAGPMYAGPLHNKEFIEEVLRINKEEHr 406 Saccharomyces cerevis...
Q9P804 314 IYHCSGCgsfaeqplgkTSP---GRLPGTTKFSnasgppvsANCEHCGYVHHVGGPLWGGPLHDAEFLKKMRAIAEDLD- 389 Schizosaccharomyces p...
Q9NXH9 345 VFQCVGCgafhlqrlgkAS----GVPSGRAKFSaacgppvtPECEHCGQRHQLGGPMWAEPIHDLDFVGRVLEAVSAN-- 418 human
Q23270 283 VLVCSGChsmeplvllkRGEgnqQSKYSIPTVRhsis-gpgNRCIHCLLPLHQIGPIYLAPIHSKPFVTSLLERLKSTPe 361 Caenorhabditis elegans
O27258 239 MLHCFRC----------LHH---EHVNGFAPLK--------RECPHCGAEMDVAGPLWVGDIQDSKFIGEMIGEVEN-K- 295 Methanothermobacter t...
O67010 244 IQYCFNC----------MNR---EVVTDLYKFK--------EKCPHCGSKFHIGGPLWIGKLWDEEFTNFLYEEAQK--- 299 Aquifex aeolicus VF5
O29443 218 LAYCSTC----------LR----KKVLGMGEG---------AERCECGGKFSLIGPIWLGELKQRDFAEKVAEKAEG--- 271 Archaeoglobus fulgidu...
Q58356 244 VKD----------------------VNGIKI----------IKKFEEGYEKGFAGPLYIGNLYDKALVEEALKIAEK--- 288 Methanocaldococcus ja...
P81554 252 VYF--------------------DEKTGRFE----------VEKSFLSTRPNAYGPLWLGPLKNEKVVGEMLELLVSGF- 300 Pyrococcus furiosus D...
P15565 407 dqDDTYgtRKRIEGMLSLAKNEL-SDSPFYFSPNHIASVIKLQVPPLKKVVAGLGSLGFECSLTHAQPSSLKTNAPWDAI 485 Saccharomyces cerevis...
Q9P804 390 --PEVYgtKRRILGMLALADEEL-PDVPFYFVLSQICSVLRSQSPPQNIFVSALLNAGYRVSGSHAKSNAIKTNAPWSFV 466 Schizosaccharomyces p...
Q9NXH9 419 --PGRFhtSERIRGVLSVITEEL-PDVPLYYTLDQLSSTIHCNTPSLLQLRSALLHADFRVSLSHACKNAVKTDAPASAL 495 human
Q23270 362 --AERLgtHGRLQGVLTMVNEE--LDDVLYYEHNQMANVVKVSVPKSQSVRSAILNAGFKVSGSHCNPRAIKTNAPMHLL 437 Caenorhabditis elegans
O27258 296 --ELNT--AGDVLKLLKGCLDEA-GMPPGFYDIHEVCSKLGRSAPPLRDVMDGLEAAGFRVSRTHIRPTGIRTDAGIGEI 370 Methanothermobacter t...
O67010 300 --REEI--EKETKRILKLIKEESqLQTVGFYVLSKLAEKVKLPAQPPIRIAVKF----FNGVRTHFVGDGFRTNLSFEEV 371 Aquifex aeolicus VF5
O29443 272 ----------KLRAFLEKILAE--IDAPTAYSLPALAKIHSLTLPPTDVVVEELKKLGYEASRTHYCGFCVKTDADRDVV 339 Archaeoglobus fulgidu...
Q58356 289 ---REF--SERVLKILNAIKGESaINQVGCYDTHQIGKMLKISVPPMQDIINKLKEMGFNAVVTHYNPKGIKTDATLKNV 363 Methanocaldococcus ja...
P81554 301 --EVAN--YREVLKLLHMLHEE--LDIPLFYDTHALGKRLKIEPKKLGEIIKELKSMGYEATRTHFSPTGIKTNAPYEVF 374 Pyrococcus furiosus D...
P15565 486 WYVMQ 490 Saccharomyces cerevisiae S288C
Q9P804 467 WDVLR 471 Schizosaccharomyces pombe 972h-
Q9NXH9 496 WDIMR 500 human
Q23270 438 WDIYR 442 Caenorhabditis elegans
O27258 371 EEVLA 375 Methanothermobacter thermautotrophicus str. Delta H
O67010 372 MKKME 376 Aquifex aeolicus VF5
O29443 340 VKILR 344 Archaeoglobus fulgidus DSM 4304
Q58356 364 IEAIY 368 Methanocaldococcus jannaschii DSM 2661
P81554 375 VEVMR 379 Pyrococcus furiosus DSM 3638
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap