2QH9


Conserved Protein Domain Family
DUF99

?
pfam01949: DUF99 
Click on image for an interactive view with Cn3D
Protein of unknown function DUF99
The function of this archaebacterial protein family is unknown.
Statistics
?
PSSM-Id: 307872
View PSSM: pfam01949
Aligned: 100 rows
Threshold Bit Score: 152.244
Threshold Setting Gi: 150421717
Created: 16-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2QH9_A     9 FLGIDDSFd---------DRK--CCVVGCVTCGGy-VEGFLYTEIDIDGLDATDKLISXVRR-SkFREQIK----CIFLP 71  Archaeoglobus fulgidus
Q6LWU7     9 VIGIDDAPfn------kfDKE--ALIVGTYMRGNklVDEISFKKIEKDGFDSTEKILKIVKDk--HFTKIN----AIFLD 74  Methanococcus marip...
Q58550    10 VIGFDDAPfn------kaDKV--CILIGTYMRGNriIDGIYFRKFKKDGMDVTEKIIDIVKEk--HYKKIK----VIFLA 75  Methanocaldococcus ...
Q6L0L2     7 VLGIDDGPfik-----nsDKR--TVITGVILKSNlyIEGISIKYIDVDGSDAEDVIISMIKGr--FKNEIS----AVMTD 73  Picrophilus torridu...
Q9HM28    32 ILGIDDSPfs------rgDRE--SNLVGVLMRMDgyVEMMEKEKIQVDGDDVNRAIENLFLY-TgRVA--R----IIMMS 96  Thermoplasma acidop...
AFH42842   7 AIGIDDGHfe-------kGKNknTVIVGVKF-NGfnPVSAFIRKIGVDRTDATERGIELIQS-A-T-EGINskdvVVFLD 75  Fervidicoccus fonti...
ACB08136  20 ILAVDDSPfe-------rGKDadTFLVGIMFR-DlvIELSMKERISVDGDDSTEALIRMVRSpK-LREEVR----VVMSH 86  Candidatus Korarcha...
EQB66531   5 ILGIVSSGfqr-----ssDTE--TSLVFVLMRCPdiVESVNFASVEVDGDDSTNTIIETLKS-R-PFPNIE----LILTK 71  Thermoplasmatales a...
ADM26855   5 YLGIDDGYfrvsaknckgVYK--TVVVGILTNNRsiID-IFIEPITIDSLDAISSIFKIIDV-AnKLYGVD----VIFLD 76  Ignisphaera aggrega...
ABR55754   9 VIGIDDAPfn------rmDKE--AILIGTYIRGNkiIDGVYFKKINRDGLDSTEKIIEIVMGk--HKTKIN----AIFLD 74  Methanococcus aeoli...
2QH9_A    72 GITLGGFNLVDIQRVYRETKIPVVVVXRRKPDxEeFDSAXR-----NLENYE-LRRKIVEVA--GEIHRIGD-----IYI 138 Archaeoglobus fulgidus
Q6LWU7    75 GVTFGGFNIADIVKIYNETKIPVIAVMEKEPDlLkMKSALKk----YFFDFP-EKIEMLESF--PKPEPFEN-----IFI 142 Methanococcus marip...
Q58550    76 GITFGGFNIADLWEINKETEKPVIVVIDKYPNkEkIFLALKk----YFDDAD-ERIKLINSF--PEPEKMEN-----IYV 143 Methanocaldococcus ...
Q6L0L2    74 GITFGGFNIVDIKNINEATGVPVISITRREPNiQrIISAVSr----YFPEKVdRALKALSNGp-VRLDN--------IYI 140 Picrophilus torridu...
Q9HM28    97 GISFAGFNICDIDALYQRIRVPVISVFEQGGSvErMIAAIEk----HLDDPE--KVRILRSL--KPVEIRNNgy--iIMA 166 Thermoplasma acidop...
AFH42842  76 GVTYAGFNFIDPEEIKEKTKMEIIAIFSRKPNqDkIENALRl----HFSDWE-YRWEHIYKVi-KNVRSIVNfr-gkLYF 148 Fervidicoccus fonti...
ACB08136  87 GTTFAGLNVVDVSRFYEETGIPLIAVTSKVPTnE-IERAIVs----A--GMI-EKLEIVRRN--PPYNPLRTpk-gvCFY 155 Candidatus Korarcha...
EQB66531  72 GISLGGLNLYDPDIICSTTKIPTASFSRVPHCrEcMEKAIRslelkKNKDES-VKLKILNSL--ETTEVTIKne--kYYV 146 Thermoplasmatales a...
ADM26855  77 GVTYAGFNIVDPKKLYNLTSIPIITVFQHELElDkIFNALKa----HFNDYK-YRFNIIHEIytNSIEIILRythnkIRI 151 Ignisphaera aggrega...
ABR55754  75 GITFGGFNIANIYKIHEETGIPVIVVIDKMPNrQnMIEALKk----HFKDGP-IRISILKSF--PKPEYLEG-----IYV 142 Methanococcus aeoli...
2QH9_A   139 QTAGLTPSEAEKLVKASLIKGNXPEPVRISHLVASAII 176 Archaeoglobus fulgidus
Q6LWU7   143 QCIGISFEDACKLIKKTRLRSKIPECLRISHLVGRGFL 180 Methanococcus maripaludis
Q58550   144 QYVGADKEFVKNVIKKTKLKSKIPECLRISHLIGRGFL 181 Methanocaldococcus jannaschii DSM 2661
Q6L0L2   141 NSAGISLTEAGILIRRFTFMGRLPEPVRLAHIISTAII 178 Picrophilus torridus DSM 9790
Q9HM28   167 NLSGIDAQSAQEIITRNTIRGKFPEAIRLADLVGKILg 204 Thermoplasma acidophilum DSM 1728
AFH42842 149 FTTIENAKDAEFLIESYQLISKLPEPIRVAHIIAKEIS 186 Fervidicoccus fontis Kam940
ACB08136 156 STIGMSGDEAERVILRYIVESKVPEQLRIVDIVSRLLa 193 Candidatus Korarchaeum cryptofilum OPF8
EQB66531 147 NATGISNNELLLILSECFKTGLLPEPLRIAQIIASGLY 184 Thermoplasmatales archaeon E-plasma
ADM26855 152 YPIGIPLKEASDLIQKLSKDFGTPYPLIFADRIASMLg 189 Ignisphaera aggregans DSM 17230
ABR55754 143 QYIGIEKEHLRAIIKKTKLKSKIPECLRISHLIGRGFL 180 Methanococcus aeolicus Nankai-3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap