3FPZ,1RP0,4Y4M


Conserved Protein Domain Family
Thi4

?
pfam01946: Thi4 
Click on image for an interactive view with Cn3D
Thi4 family
This family includes a putative thiamine biosynthetic enzyme.
Statistics
?
Aligned: 7 rows
Threshold Bit Score: 316.329
Threshold Setting Gi: 6094475
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3FPZ_B    49 SRAMTSRYFKDLDKFAVSDVIIVGAGSSGLSAAYVIAKNrpDLKVCIIESSVAPGGGSWLGGQLFSAMVMRKPAHLFLQE 128 baker's yeast
ENH66155  55 SRAMTRRYFQDLDNYAESDIVIIGAGSCGLSAAYILGKKrpDLKIAIIEASVSPGGGAWLGGQLFSAMIMRKPADAFLRE 134 Fusarium oxysporum ...
P40998    60 SRAMTRRYFSDLDKYAESDIVIVGAGSAGLTAAYYIGTRrpDLKIAIIEASVAPGGGAWLGGQLFSAMVVRKPADLFLNE 139 Schizosaccharomyces...
1RP0_B    23 SREMTRRYMTDMITYAETDVVVVGAGSAGLSAAYEISKNp-NVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDE 101 thale cress
O27657     9 SRAIVEGYMEDLLDYMEMDVAIGGGGPSGLTAGYYLARA--GLKVALFERKLSIGGGMWGGGMMFNKIVVQDEGREILDE 86  Methanothermobacter...
4Y4M_E    43 TKAILKASFDMWLDIVEADVVIVGAGPSGLTCARYLAKE--GFKVVVLERHLAFGGGTWGGGMGFPYIVVEEPADELLRE 120 Methanocaldococcus ...
O29556    14 TKAIVETASEEWVEYAESDVIVVGAGPSGLTAARYLAEK--GLKTLVLERRLSFGGGIGGGGMLFHKVVVEREAKDILDD 91  Archaeoglobus fulgi...
3FPZ_B   129 LEIPYEDEGDYVVVKHAALFISTVLSKVLQlPNVKLFNATCVEDLVTRPptekGeVTVAGVVTNWTLVTQA--HgtqcxM 206 baker's yeast
ENH66155 135 VGVPYEDEGNYVVVKHAALFTSTIMSKVLQmPNIKLFNATCVEDLITRPse-eG-VRIAGVVTNWTLVSMH--HddqscM 210 Fusarium oxysporum ...
P40998   140 IGVPYEDEGDYVVVKHAALFTSTVMARTLAlPNVKLFNATAVEDLIVKEgk-dGkQRIAGVVTNWTLVSLN--HglqscM 216 Schizosaccharomyces...
1RP0_B   102 IGVAYDEQDTYVVVKHAALFTSTIMSKLLArPNVKLFNAVAAEDLIVKG------NRVGGVVTNWALVAQN--HhtqscM 173 thale cress
O27657    87 FGIRSEPYDEGYHVADSVEATSTLCSRACQ-AGLKIFNLMSIEDVMIRD------EGITGLVLNWSSVEMAglH-----V 154 Methanothermobacter...
4Y4M_E   121 VGIKLIDMGDGYYVADSVEVPAKLAVAAMD-AGAKILTGIVVEDLILRE------DGVAGVVINSYAIERAglH-----I 188 Methanocaldococcus ...
O29556    92 FGIRYTEHRN-FLVADSAEFMAKLAAKAID-AGAKIIHGVSVEDVIFRD----DpLGVRGVCIQWSAVEISglH-----V 160 Archaeoglobus fulgi...
3FPZ_B   207 DPNVIELAgykndgtrdlsqkhgVILSTTGHDGPFGAFCAKRI--VDIDQNQKLGGMKGLDMNHAEHDVVihSGAYAGVD 284 baker's yeast
ENH66155 211 DPNTINAP---------------LIISTTGHDGPMGAFCVKRL--VSMQRIEKLGGMRGLDMNLAEDAIV--KGTREIVP 271 Fusarium oxysporum ...
P40998   217 DPNTINAH---------------LVVSATGHDGPFGAFCVKRL--ASAQLVSNLHDMRPLDMNRAEDLIV--KGTREVFP 277 Schizosaccharomyces...
1RP0_B   174 DPNVMEAK---------------IVVSSCGHDGPFGATGVKRL--KSIGMIDHVPGMKALDMNTAEDAIV--RLTREVVP 234 thale cress
O27657   155 DPLTVRAR---------------AVIDATGHDCEIVKVVERKIgpELNTPDGRIQGERSMWADVGEAALI--ENTREVYP 217 Methanothermobacter...
4Y4M_E   189 DPLTIRSK---------------VVVDATGHEASIVNILVKKN--KLEA---DVPGEKSMWAEKGENALL--RNTREVYP 246 Methanocaldococcus ...
O29556   161 DPLFLRSR---------------AVVDATGHDAEVISVAARKI--PLEV---SVVGERSAYSEVAEREIV--EKTGKIVK 218 Archaeoglobus fulgi...
3FPZ_B   285 NMYFAGMEVAELDGLNRMGPTF 306 baker's yeast
ENH66155 272 GLIVGGMELSEVDGANRMGPTF 293 Fusarium oxysporum f. sp. cubense race 1
P40998   278 GMIVGGMELSEFDGANRMGPTF 299 Schizosaccharomyces pombe 972h-
1RP0_B   235 GMIVTGMEVAEIDGAPRMGPTF 256 thale cress
O27657   218 NLYVAGMASNAVYGAPRMGPIF 239 Methanothermobacter thermautotrophicus str. Delta H
4Y4M_E   247 NLFVCGMAANASHGGYRMGAIF 268 Methanocaldococcus jannaschii DSM 2661
O29556   219 GLYAAGMAVAAVHNLPRMGPIF 240 Archaeoglobus fulgidus DSM 4304
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap