5GK9


Conserved Protein Domain Family
MOZ_SAS

?
pfam01853: MOZ_SAS 
MOZ/SAS family
This region of these proteins has been suggested to be homologous to acetyltransferases.
Statistics
?
PSSM-Id: 396431
View PSSM: pfam01853
Aligned: 136 rows
Threshold Bit Score: 230.774
Threshold Setting Gi: 523779869
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5GK9_A        58 PPGDEIYRKGSISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEAd----------------nTGCHL 121
EME42745      88 PHGEVIYETDEYMIHKLDGEEYKLYCQNLSLFAKLFLETKSVFFDASTFLYYTLILKprrgeskapttssinapnPYGTV 167 Dothistroma sep...
EMF12360      31 PHGEVIYDQDNYAIHKLDGEEHKLYAQNLSLFAKLFLETKSVFFDASTFLFYTLVLRdpss-----------ksnPHGEV 99  Sphaerulina mus...
Q6C7N8       158 HPGETVYKSKDYAIRRVDGAVHKLYCQNLCLFAKLFLDHKSVFFGADAFEFYVVLGKdta-------------ssRHFKP 224 Yarrowia lipoly...
XP_004181843 109 APGRIMYKSPDITIRRVKGWKHELYCQCLCLFTKLFLDNKSMYFKLPHYEFYIIYKTg----------------sT--KP 170 Tetrapisispora ...
XP_002494755 106 SPGKIKYKSPNYTIKRVKGTKHRLFCQCLCLFTKLFLDNKSMYFKVDHYEFYIVYETs----------------sT--KP 167 Zygosaccharomyc...
XP_003678727  99 APGRIKYKSPSYTIRRVKGSRHRLFCQCLCLFTKLFLDNKSMYFKVDHYEFYVVYRTg----------------eF--KP 160 Torulaspora del...
CCK70482     151 SPGRIKYKSPEYTIRRVKGFKHQLFCQNLCLFTKLYLDNKSMYFKVEHYDFYILYQTg----------------lH--KP 212 Kazachstania na...
XP_003954614 129 APGRIKYKSPEYTIRRVKGSKHKLFCQCLCLFTKLFLDNKSMFFRLDNYDFYILYETg----------------sT--KP 190 Kazachstania af...
XP_003671695 205 PPGRIKYKSTKYTIRRVKGYKHKLFCQCLCLFTKLFLDNKSMYFKVDHYDFYILYETg----------------tStPNP 268 Naumovozyma dai...
5GK9_A       122 IGYFSKEKNS-FLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYW----KEVLLR-Y 195
EME42745     168 AGFFSKEKMS-WDNNNLACILIFPPYQRRGLGQVLMASSYVLGRREGRFGGPERPLSALGRKSYVRFW----CGEVAR-C 241 Dothistroma sep...
EMF12360     100 VGFFSKEKMS-WDNNNLACIVVFPPWKQRGLGQILIAASYVLGRRENRFGGPERPLSADGRKSYVKYW----TGAVAReV 174 Sphaerulina mus...
Q6C7N8       225 MGFFSKEKLS-WDENNLACILVFPPYQRRGLGKLLIEFSYVLSKYEGRKGSPERPLSKFGTLSYMSYW----CTTIAR-F 298 Yarrowia lipoly...
XP_004181843 171 MGYFSKDILSyA-RYNLACILTFPPYQRQHVGTYLMEFSYKLSKLEGIASGPETPLSPFGLISYINYWsriiAMELLEgE 249 Tetrapisispora ...
XP_002494755 168 MGFFSKDTVSyY-QNNLACVLVFPPYQRRQLGTFLLDFSYKISKSEGLISGPEFPLSPFGLIGYVKYWslkiCWEFSEgE 246 Zygosaccharomyc...
XP_003678727 161 MAFFSKDLVSyH-QNNLACILTFPPYQRLRLGTLLLEFSYKLSTFDNLISGPELPLSPFGLISYLKYWskviCWELVEgE 239 Torulaspora del...
CCK70482     213 MAFFSKELISyS-QNNLACILTFPPYQRKRLGSLLIEFSYKLSQADGIVSGPELPLSPFGLVGYLKYWsrviCWHMVNgV 291 Kazachstania na...
XP_003954614 191 MGFFSKDLVSyN-QNNLACILVFPPYQRRNLGTLLIEFSYKLSKLDSIVSGPEVPLSPFGLISYLKVWsqllCYHLLEgD 269 Kazachstania af...
XP_003671695 269 MGFFSKDLISyN-RNNLACILVFPPYQRRKLGSLLIEFSYKLSKFDNITSGPELPLSPFGLIGYLKYWsqiiCWELIEgQ 347 Naumovozyma dai...
5GK9_A       196 LHNF-QGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKGK 236
EME42745     242 VLTGgAKRTLGIKEISEETWVMPEDVVLALKEMDVLETRKTA 283 Dothistroma septosporum NZE10
EMF12360     175 LLGGhGKKVLSVKDLAEKTWIMPEDVVVALKEMDVFEKRKTA 216 Sphaerulina musiva SO2202
Q6C7N8       299 ILIEcTEDVITIETISEHTYIQPEDVMRALKEMHAVVLYSDE 340 Yarrowia lipolytica
XP_004181843 250 LM---GYNYVTLEMISKVTGFRISDIITTFKQLDCLDENDNI 288 Tetrapisispora blattae CBS 6284
XP_002494755 247 LA---NMEKITLENISSVTGFRISDIITALKYLGCLGESDEI 285 Zygosaccharomyces rouxii
XP_003678727 240 LA---NCEKLTIETIAKVTGIRIPDIILTMEYLKCLGNTHEI 278 Torulaspora delbrueckii
CCK70482     292 FA---DLDGATLEELSTVTGLRINDLITTLKYLQCVGPDNKI 330 Kazachstania naganishii CBS 8797
XP_003954614 270 LT---TMGGISLKQLSSVTGLRINDIIMTLKHLNCIGDDNKI 308 Kazachstania africana CBS 2517
XP_003671695 348 LA---NFDGVTLENISTVTGLRINDIIMTLKHLGCIGENNQI 386 Naumovozyma dairenensis CBS 421
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap