Conserved Protein Domain Family
Ribosomal_L29e

?
pfam01779: Ribosomal_L29e 
Ribosomal L29e protein family
Statistics
?
Aligned: 72 rows
Threshold Bit Score: 40.9914
Threshold Setting Gi: 122100061
Created: 30-Apr-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001606325               4 SKNHTNHNQSRKAHRNGIKKPKRNLHESTLGMDLKFLRN 42  jewel wasp
ELA41217                   4 RTNHTNRNQNRKDHKHGIKKPKRHALIDTPGVNIARLRN 42  Vittaforma corneae ATCC 50505
ELA47045                   4 RKNTSHHNQNRKDHRNGIKQPDRNS-LSTNGTDDKILRN 41  Vavraia culicis subsp. floridensis
EAX98440                   4 RSNTSAHNRSHQHHRNGIHKCVVKKLWFEKGMNAKFLRN 42  Trichomonas vaginalis G3
WGS:AAFB:cds.EHI_023220A   4 DKNRSSHNQSHKAHRNGFYKPKKSAYMSTKGMNVQVLKN 42  Entamoeba histolytica HM-1:IMSS
GAA83448                   4 SKNASQHHNSQKAHRNGISTNIQHSTYSSSGINTQqlqr 42  Aspergillus kawachii IFO 4308
EDO76423                   4 LKNHTSKNQNRKDHRNGIKKPKKSAYTSHKGMCPKYLRN 42  Giardia lamblia ATCC 50803
A0D2E6                     4 SKNATSHHNARKHHRNGIKKLPNQRYTSLNGCNQRFAKN 42  Paramecium tetraurelia
EFA78063                   4 SKNHSTHHRNSKEHRNGIKKPVVHAKTSSKGLDTKFARN 42  Heterostelium album PN500
WGS:AFBI:EDEG_00184        4 KKNHTNHNQNKKHHRNGIKRVKFSKKPDFTGVNPKIIKN 42  Edhazardia aedis USNM 41457
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap