Conserved Protein Domain Family
Herpes_UL6

?
pfam01763: Herpes_UL6 
Herpesvirus UL6 like
This family consists of various proteins from the herpesviridae that are similar to herpes simplex virus type I UL6 virion protein. UL6 is essential for cleavage and packaging of the viral genome.
Statistics
?
PSSM-Id: 280017
View PSSM: pfam01763
Aligned: 11 rows
Threshold Bit Score: 668.692
Threshold Setting Gi: 395406798
Created: 15-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6UDH0  55 MGFrEVLLGAPAYSPGHGIYNAVRATSTVIRQVQASVLRNILDGVAFEDLADDWRAHISArgfapgdlAEKYWL-EPADA 133 Psittacid herpesvirus...
O36392  14 NLF-EILQGKYAYVKGQTLYSSVRNSGTFFRQVFTNIYRDALSSCTYEDVLQDWIKYETS--------IRQRWKpSEKED 84  Alcelaphine herpesvir...
P03213  29 RLF-EILQGKYAYVQGQTIYANLRNPGVFSRQVFTHLFKRAISHCTYDDVLHDWNKFEAC--------IQKRWPsDDSCA 99  Epstein-Barr virus (s...
P52454  77 MTFiEMLHGHKNFFKGQTIHNALRDSAVLKKQIAYGVAQALLNSVSIQQIHDEWKRHVRSfpfhnkklS----------- 145 Human herpesvirus 6 s...
F5HBR4  65 MSFlRLLHGFLGTCRGQSMHQVLRDPCVLRKQLLYGVCKTLFDTITVRRVAEEWKLHAALfpyraldeED---------- 134 Human herpesvirus 5 s...
P09302  74 MLFrKILAGDFGYTDGQGIYSAVRSTETVIRQVQATVLMNALDATRYEDLAADWEHHIQQcnlhagalAERYGLcGESEA 153 Human herpesvirus 3 s...
Q9E6R0  56 M-FkEILAGRLGYTDGQGIYNSVRSTETAIRQIQNTILTLSLDAVRYDDLKNDWIRHADMrgmsakklARTYGMhSEAEA 134 Marek's disease herpe...
P10190  37 MLFrEILHGQLGYTEGQGVYNVVRSSEATTRQLQAAIFHALLNATTYRDLEADWLGHVAArglqpqrlVRRYRNaREADI 116 Herpes simplex virus ...
Q01029  20 HLF-EILQGKYAYVKGQTLHSSLRNPGVFSRQLFIHIYKTVLSSCTYDHVISDWHKYEDN--------IKTRWKnENFTS 90  Herpesvirus saimiri (...
F5HGK9  22 SLF-EILQGKYSYVRGQTLHCSLRNPGVFFRQLFIHLYKNALANCSYDHVLSDWRTYESS--------AKTRWPeKEAQW 92  Human herpesvirus 8 s...
Q66646  20 PLF-EILQGKYSYVKGQTLHSSLRNPGVFSRQLFVHLYKRALSRCTYDEVLSDWQLFEAG--------IRARWRgSRYES 90  Equid herpesvirus typ...
Q6UDH0 134 VRVAENATETWSFLLRNLLLDFVRRVaeycIDGM--GGADGTAAYARYVDWLTCLGIVPV--IREGDVADd--sAGKGTE 207 Psittacid herpesvirus...
O36392  85 NAFKWSTFQSWFSTMKMTIDGIITKA----ITYI--INTKCIASYERYIDWVATCGVVPV--LNQRPNSK----VVQMFK 152 Alcelaphine herpesvir...
P03213 100 SRFRESTFESWSTTMKLTVRDLLTTN----IYRV--LHSRSVLSYERYVDWICATGMVPA--VKKPITQE----LHSKIK 167 Epstein-Barr virus (s...
P52454 146 ---FQDYFSVWAHAIKQVILGDISNI----INFI--LQSIDNSHYNRYVDWICTVGIVPF--MRTTPTAPnlynLLQQVS 214 Human herpesvirus 6 s...
F5HBR4 135 ---LEQYLLVWSASLRQSVQTGVLGA----LRDIl-YQYADNDDYGLYVDWCVTVGLVPLldVKTKPSEAa--eRAQFVR 204 Human herpesvirus 5 s...
P09302 154 VRLAHQVFETWRQTLQSSLLEFLRGI----TGCLytSGLNGRVGFAKYVDWIACVGIVPV--VRKVRSEQn--gTPAPLN 225 Human herpesvirus 3 s...
Q9E6R0 135 VKVAENVFVTWRKTLQTTLINLARQL----ISCFt-TANINTSSFSKYIDWICCLGIVPV--VRHDRSAR----ATSSIP 203 Marek's disease herpe...
P10190 117 AGVAERVFDTWRNTLRTTLLDFAHGL----VACFapGGPSGPSSFPKYIDWLTCLGLVPI--LRKRQEGG----VTQGLR 186 Herpes simplex virus ...
Q01029  91 DSFRKSTYQSWAQTMRMTIDQLVLNN----IYQI--IHSK-ITSYERYTDWVMALGLVPV--VKQLPDEK----LIRQIQ 157 Herpesvirus saimiri (...
F5HGK9  93 GSYRRSTFDSWAQTMRMTLDHLLLNA----INRV--LYAKTQLSYERYVDWVVTVGMVPV--VKHTPDHK----LVNSIQ 160 Human herpesvirus 8 s...
Q66646  91 GAFKASTFQSWVDTVKMTLDQLLLNN----IYHI--LHTRTNLSYERYVDWVVAVGLVPL--FVSKPDRA----LVKSIT 158 Equid herpesvirus typ...
Q6UDH0 208 RFVADTEWDl-----SMQNrlRLAPAITRRGYDMLGCLERCFRAARVMNYDRTVVIMHSATRELRAYdvHTRERGGCVVA 282 Psittacid herpesvirus...
O36392 153 KHLEKEYSS------VASS--KSLTTIFHFLVESASSVLERLTSKFIPSYLEVSVTYDQYKCEYKAS--YQNKEIGVEVI 222 Alcelaphine herpesvir...
P03213 168 SLRDRCVCR------ELGHe-RTIRSIGTELYEATKEIIESLNSTFIPQFTEVTIEYLPRSDEYVAY--YCGRRIRLHVL 238 Epstein-Barr virus (s...
P52454 215 S--------------------KLIHDIVRHKQNIVTPILLGLSSVIIPDFHNIKIFRDRNSEQISCF--KNKKAIAFFTY 272 Human herpesvirus 6 s...
F5HBR4 205 AAVQR-----------ATEthPLAQDLLQANLALLLQVAERLGAVRIANAPEVRVFKKVRSERLEAQ--LRGKHIRLYVA 271 Human herpesvirus 5 s...
P09302 226 TYMGQAA--------ELSQmlKVADATLARGAAVVTSLVECMQNVAIMDYDRTRLYYNYNRRLIMAKddVTGMKGECLVV 297 Human herpesvirus 3 s...
Q9E6R0 204 TCAGRSTVFpnwafhDASSrlRVVDSVMARGKQIVNYLSNSMSAVSILEYDRTLIEYNFFKRELRVKdiLSGERGECIVI 283 Marek's disease herpe...
P10190 187 AFLKQH---------PLTRqlATVAEAAERAGPGFFELALAFDSTRVADYDRVYIYYNHRRGDWLVRdpISGQRGECLVL 257 Herpes simplex virus ...
Q01029 158 SQLSAASKI------AAGNd-RVMRTILSALEYTVTDMLETLTSIYIPDYSEVTIDYRSKDQLFVGT--YKGKHIAVEVI 228 Herpesvirus saimiri (...
F5HGK9 161 EQLMKDCQR------LASGe-KTIGRILTSVTQEISNLVSSLSALYIPGYSEVSIDYDCVKNTFVGL--YKQKRVHVEVI 231 Human herpesvirus 8 s...
Q66646 159 SKFSADSVG------FSSDkyKTMKTVLMTFKRELTSVLETVTSIYIPDFSEVQLYFDGSTTAYFGV--YRGQRITVEVV 230 Equid herpesvirus typ...
Q6UDH0 283 WDPMLT-ERGIVFDSPMQRLYAAVLRTQAVREHAKLCQLANTAPVSVLVARREDKvaadpagvskLVDKALGEGAEEAGQ 361 Psittacid herpesvirus...
O36392 223 IPPTIG-SGKVVFNSPVQRLAENVMACHRTMEHAKICQLLNTGPLKAIVCSSSAT----------VYKDILNHLDECGKK 291 Alcelaphine herpesvir...
P03213 239 FPPAIF-AGTVTFDSPVQRLYQNIFMCYRTLEHAKICQLLNTAPLKAIVGHGGRD----------MYKDILAHLEQNSQR 307 Epstein-Barr virus (s...
P52454 273 STPYVI-RNRLMLTTPLAHLSPELKKHNSLRRHQKMCQLLNTFPIKVLTAAKTDV----------TNKKIMDMIEKEEKN 341 Human herpesvirus 6 s...
F5HBR4 272 AEPLAYeRDKLLFTTPVAHLHEEILRYDGLCRHQKICQLLNTFPVKVVTASRHEL----------NCKKLVEMMEQHDRG 341 Human herpesvirus 5 s...
P09302 298 WPPVVC-GEGVVFDSPLQRLSGEVLACYALREHARVCQVLNTAPLRVLIGRRNEDdrsh---strAVDRIMGENDTTRAG 373 Human herpesvirus 3 s...
Q9E6R0 284 WRPVMN-DGGVIFDSPMQRIYKEIIECHDLRQHATLCRLVNTAPVKVLIAKRDDGckgva-gaqrVIDKVLGDQPENAAS 361 Marek's disease herpe...
P10190 258 WPPLWT-GDRLVFDSPVQRLFPEIVACHSLREHAHVCRLRNTASVKVLLGRKSDSergva-gaarVVNKVLGEDDETKAG 335 Herpes simplex virus ...
Q01029 229 TRPVI--AKNIFFDSPVQRLFQNIMSCYRTTEHAKLCQLLNTAPIKAICGASTQN----------VYKDILSHLEQNSQK 296 Herpesvirus saimiri (...
F5HGK9 232 TMPAIL-AGRVIFDSPIQRMYTSIMSCHRTAEHAKLCQLLNTAPTKALVGSACNN----------VYKDIMTHLEQASQR 300 Human herpesvirus 8 s...
Q66646 231 NRPIIF-NGEVTFDSPVQRLFNTVMSCHRTAEHAKLCQLLNTSPMKAVVGSTSNN----------LYKDILNHLEQSSHK 299 Equid herpesvirus typ...
Q6UDH0 362 SAAAK-LIKFIIDMQNMRKVGDVAEVVDAYLRESGGPAIDKTFSldpg----ragFGGNGKsaqgll------gqqgqpN 430 Psittacid herpesvirus...
O36392 292 NDPKKeLMQLLIKLAENKTVNGVTDVVEDFITDVSNKLVDRSKL-----------FGDVNA------------------E 342 Alcelaphine herpesvir...
P03213 308 KDPKKeLLNLLVKLSENKTISGVTDVVEEFITDASNNLVDRNRL-----------FGQPG-------------------E 357 Epstein-Barr virus (s...
P52454 342 SDAKKsLIKFLLNLSDSKSKIGIRDSVEGFIQEITPSIIDQNKLmln-----rgqFRKRSAi-----------------D 399 Human herpesvirus 6 s...
F5HBR4 342 SDAKKsIMKFLLNVSDSKSRIGIEDSVESFLQDLTPSLVDQNRLlpargpggpgvVGPGGAvvggpaghvgllppppgpA 421 Human herpesvirus 5 s...
P09302 374 SAASR-LVKLIVNLKNMRHVGDITETVRSYLEETGNHILEGSGSvdts----qpgFGKANQsfngg--------amsgtT 440 Human herpesvirus 3 s...
Q9E6R0 362 SAASR-LVKLIIGLKGMRHVGDITDTVRDYLEETSGHLLD-AASidts----qpgFGQSNRaqsstte-----etrrntI 430 Marek's disease herpe...
P10190 336 SAASR-LVRLIINMKGMRHVGDINDTVRSYLDEAGGHLID-APAvdgt----lpgFGKGGNsrgsagq-----dqggraP 404 Herpes simplex virus ...
Q01029 297 SDPKReLLSLLVKLAENKTVSGVTDVVEEFITDVSQNIVDKNKL-----------FGSQ--------------------E 345 Herpesvirus saimiri (...
F5HGK9 301 TDPKReLLNLLMKLAENKTVSGVTDVVEDFVTDVSQNIVDKNKL-----------FGTGQ-------------------E 350 Human herpesvirus 8 s...
Q66646 300 SDPKReMLQLLIKLAENKTVSGITDVVEDFVTDVSQNIVDRNKL-----------FGGGGGgp--------------saE 354 Equid herpesvirus typ...
Q6UDH0 431 QPKDGVASVMRDAVNTSVGKVVNNLFKAVSDLKSANADLTRRNAHIAKELTES--------RRRIGAltsAAARDNSNGS 502 Psittacid herpesvirus...
O36392 343 HPSDNLKKQVSNNVFKCLTQQINQQFETISKLEEERAFFLKKINQIETQLSKC--------QEEPQG---TGGKPYNILT 411 Alcelaphine herpesvir...
P03213 358 TAAQGLKKKVSNTVVKCLTDQINEQFDQINGLEKERELYLKKIRSMESQLQASlgpggnnpAASAPAavaAEAASVDILT 437 Epstein-Barr virus (s...
P52454 400 TGERDVRDLFKKQIIKCMEEQIQTQMDEIETLKTTNQMFERKIKDLHSLLETN--------------------NDCDRYN 459 Human herpesvirus 6 s...
F5HBR4 422 APERDIRDLFKKQVIKCLEEQIQSQVDEIQDLRTLNQTWENRVRELRDLLTRY-----------------ASRREDSMSL 484 Human herpesvirus 5 s...
P09302 441 NVQSAFKTSVVNSINGMLEGYVNNLFKTIEGLKDVNSDLTERLQFKEGELKRL--------REERVKikpSKGSHITMAE 512 Human herpesvirus 3 s...
Q9E6R0 431 KIRDAFHSSVVTSINEMLEGYVNKLFNTVEGLKAANKDLLAKLCSKELELDRV--------RTEHLi---SKQAHTDMGN 499 Marek's disease herpe...
P10190 405 QLRQAFRTAVVNNINGVLEGYINNLFGTIERLRETNAGLATQLQERDRELRRA--------TAGALe---RQQRAADLAA 473 Herpes simplex virus ...
Q01029 346 STTQGLKKHVSNNVFKCLTSQINEQFDTINKLEKERELYLGKINQIETQLLHL--------TQDEKQ----SVSPDNVLV 413 Herpesvirus saimiri (...
F5HGK9 351 TTTQGLRRQVSNSVFKCLTNQINEQFDTITQLEKERELCMKRLKCIETQLSHQ--------QPGDAK----GPGSVNLLT 418 Human herpesvirus 8 s...
Q66646 355 STAQGLKKQVSGTVFKCLTNQINEQFDTIHKLEKERDMMLRKVHTLETHLSQC--------RAEDKRlgeVSITS-SLLT 425 Equid herpesvirus typ...
Q6UDH0 503 SRYDApdawrvldekdarwemgdtllSLGNLpESVTMNKv-----dLSGEMTEDQYVANSFFSRYVPPYLEEESRLSALW 577 Psittacid herpesvirus...
O36392 412 SSTLD---------------------ALDGL-SQSGLHL-------TSNQVTKGQSIVNSFFSQYVPPFRELQNDLHELW 462 Alcelaphine herpesvir...
P03213 438 GSTAS---------------------AIEKLfNSPSASL-------GARVSGHNESILNSFVSQYIPPSREMTKDLTELW 489 Epstein-Barr virus (s...
P52454 460 PDLDH---------------------DLENLsLSRALNIvqr-lpfTSVSIDDTRSVANSFFSQYIPDTQYADKRIDQLW 517 Human herpesvirus 6 s...
F5HBR4 485 GARDA---------------------ELYHLpVLEAVRKardaapfRPLAVEDNRLVANSFFSQFVPGTESLERFLTQLW 543 Human herpesvirus 5 s...
P09302 513 ETRIA---------------------------------DlnhevidLTGIIGDDAYIANSFQSRYIPPYGDDIKRLSELW 559 Human herpesvirus 3 s...
Q9E6R0 500 SQYSP---------------------TLETL-----ARDlkhdvidVGEVMDDDSYVANSFQSRYIPAYDVDLKRLSELW 553 Marek's disease herpe...
P10190 474 ESVTG---------------------GCGSRpAGADLLRadydiidVSKSMDDDTYVANSFQHPYIPSYAQDLERLSRLW 532 Herpes simplex virus ...
Q01029 414 SDTFC---------------------SLQTL-QSSKLSM-------TSSDVPKGAAVLNSFFSQYVPPFRELNKDLTLLW 464 Herpesvirus saimiri (...
F5HGK9 419 ANTFQ---------------------SLGRL-QDPSLQL-------TSSHIPSGSAVLNSFFSSYIPPVRESMKDLTNLW 469 Human herpesvirus 8 s...
Q66646 426 TDTLK---------------------SLLNI-HDSSLSL-------HAASVNKGDNVHNSFFSQYVPPFREVSQDLTSLW 476 Equid herpesvirus typ...
Q6UDH0 578 ERELLRVFKMHRVTNNQGDEVSISYSNSSISLIVGPFFHRVLKATRLGfLVADDEAYKSEEELCESLFKKSRVDAYLRDL 657 Psittacid herpesvirus...
O36392 463 EHEIMQSFNLSPIIDNQGQRLFVRYTQDTIFFLLGPFTHNILGFVDME-LLIEAYCTLSFYDIAEYLYSASRLAIYIVDI 541 Alcelaphine herpesvir...
P03213 490 ESELFNTFKLTPVVDNQGQRLYVRYSSDTISILLGPFTYLVAELSPVE-LVTDVYATLGIVEIIDELYRSSRLAIYIEDL 568 Epstein-Barr virus (s...
P52454 518 EMEYMRTFRLRKNVNNQGQEESITYSNYSIELLIVPFLRRLLNIYNLE-SIPEEFLFLSLGEILLAIYESSKIKHYLRLV 596 Human herpesvirus 6 s...
F5HBR4 544 ENEYFRTFRLRRLVTHQGAEEAIVYSNYTVERVTLPYLCHILALGTLD-PVPEAYLQLSFGEIVAAAYDDSKFCRYVELI 622 Human herpesvirus 5 s...
P09302 560 KQELVRCFKLHRVNNNQGQEISVSYSNASISLLVAPYFSFILRATRLGfLVTQSEVHRSEEELCQAIFKKARTESYLSQI 639 Human herpesvirus 3 s...
Q9E6R0 554 EQEMLRCFKLTRATNNQGHEVSISYSNSAITLLLAPYFFSVLNIYDIGpIVTNHEVYKSEEELCNSVFEKTRIHVYLDDL 633 Marek's disease herpe...
P10190 533 EHELVRCFKILCHRNNQGQETSISYSSGAIAAFVAPYFESVLRAPRVGaPITGSDVILGEEELWDAVFKKTRLQTYLTDI 612 Herpes simplex virus ...
Q01029 465 ESEIFHTFKLTPVVDPQGQRLYVKYTQDTVTILIGPFTYSITKLHQME-LINDIFVSMSFNDIASYIYSTSRLAVYIADI 543 Herpesvirus saimiri (...
F5HGK9 470 ESEMFQTYKLAPVVDNQGQRLSVTYSQDTISILLGPFTYVIADLLQME-LISHSFVSSSLQDIAAYLYQTSRLFVYITDV 548 Human herpesvirus 8 s...
Q66646 477 ESEVFETFKLTPVIDNQGQRLYVKYSQDTVSVLLGPFTYVITKMYEME-LITDVYSSLSLNEIADGLYKSSRLYVYMQDV 555 Equid herpesvirus typ...
Q6UDH0 658 KTTY 661 Psittacid herpesvirus 1 Amazon parrot/1997
O36392 542 GQKY 545 Alcelaphine herpesvirus 1 strain C500
P03213 569 GRKY 572 Epstein-Barr virus (strain B95-8)
P52454 597 YVRe 600 Human herpesvirus 6 strain Z29
F5HBR4 623 CSRE 626 Human herpesvirus 5 strain Merlin
P09302 640 RILY 643 Human herpesvirus 3 strain Dumas
Q9E6R0 634 ALIF 637 Marek's disease herpesvirus type 1 strain MD5
P10190 613 AALF 616 Herpes simplex virus (type 1 / strain 17)
Q01029 544 GNKY 547 Herpesvirus saimiri (strain 11)
F5HGK9 549 GQKY 552 Human herpesvirus 8 strain GK18
Q66646 556 GAKY 559 Equid herpesvirus type 2 strain 86/87
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap