2ZE5


Conserved Protein Domain Family
IPT

?
pfam01745: IPT 
Click on image for an interactive view with Cn3D
Isopentenyl transferase
Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid.
Statistics
?
Aligned: 8 rows
Threshold Bit Score: 348.229
Threshold Setting Gi: 505399032
Created: 30-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2ZE5_A            1 MLLHLIYGPTCSGKTDMAIQIAQETGWPVVALDRVQCCPQIATGSGRPLESELQSTRRIYLD-SRPLTEGILDAESAHRR 79  Agrobacteriu...
UoN:A3L23_04945  20 PGVYAIVGATGIGKSAEASKLALSHSAPIVVADRIQCYSDLLVTSGRAFDAKVEGLNRVWLD-NRTIHQGNFDPDEAFDR 98  Rhodococcus ...
P06524            1 MILHLIYGPTCSGKTDMAIQIAQETGWPVVALDRVQCCPQIATGSGRPLESELQSTRRIYLD-SRPLTEGILDAESAHRR 79  Agrobacteriu...
P15653            1 MDLRLIFGPTCTGKTSTAIALAQQTGLPVLSLDRVQCCPQLSTGSGRPTVEELKGTTRLYLD-DRPLVKGIITAKQAHER 79  Agrobacteriu...
Q04590            1 MEAHLIFGPTSTGKTSVAIALAKRTGFPVIVLDRIQCYSQLSVGGGRPSAAEFQGTRRIYLI-EGSLDEGVISAERAHEC 79  Agrobacteriu...
Q47851            3 GNVYLLWGATTTGKTAFSVSVAKERGWSVIALDRFQGYHEISTGSGAPTNNELEKTERIYITpQRGLADGIITAKDYNYW 82  Pantoea aggl...
P06619            1 MKIYLIWGATCTGKTEHSIKLSKSTGWPVIVLDRVQCCFDIATGSGRPHPEELQSTRRIYLD-NRRISEGVISAEEANDR 79  Pseudomonas ...
OYQ09840          3 IRLYLIWGATTTGKTAQSVALARATGAPVISLDRVQCCHELAVGSGRPLPSELLGTRREYLC-DRSVSSGVIPAADANQL 81  Ralstonia so...
2ZE5_A           80 LIFEVDWRKS-EEGLILEGGSISLLNCMAKSPFWrSGFQWHVKRLRLGDSDAFLTRAKQRVAEMFAIREDRPSLLEELAE 158 Agrobacteriu...
UoN:A3L23_04945  99 LIKVLTSYVDrGEAVVMEGGSISLILRFAQTISN-LPFPAVVNVMPIPDRQHYFAQQCARARQMLRGDSTGRNLLTELAE 177 Rhodococcus ...
P06524           80 LIFEVDWRKS-EDGLILEGGSISLLNCMAKSPFWrSGFQWHVKRLRLGDSDAFLTRAKQRVAEMFAIREDRPSLLEELAE 158 Agrobacteriu...
P15653           80 LIAEVHNHEA-KGGLILEGGSISLLRCMAQSRYWnADFRWHIIRNELADEESFMSVAKTRVKQMLRP-SAGLSIIQELVQ 157 Agrobacteriu...
Q04590           80 LVAAVEAHKP-EGGVILEGGSISLFKRMAQSSYWnCGFTWHVTRLHLGGEEIFLAAAKKRINQMMQPDEQGNSFLGELVS 158 Agrobacteriu...
Q47851           83 LKSRVLSLPEgKSDFIIEGGSVSLLKEMVSDEFW-ADFLWEIKIFRAPSKDVFIKRAKRRITDMLHPEDGRPSIMDEVSS 161 Pantoea aggl...
P06619           80 LKLEVNKHID-SGGVILEGGSISLLKLISKDPYWcDRFIWSQHRMRLQDTDVFMDKAKARVRRMLVGSTETTGLLDELVA 158 Pseudomonas ...
OYQ09840         82 LFDKVVRYSAhERALILEGGSVSLINAMIRDARWsALGEWALRRIVLPGRAVFIAQAIKRVRDMLEPPPGHASILDELEG 161 Ralstonia so...
2ZE5_A          159 LWNYPAARPILEDIDGYRCAIRFARKHDLAISQLPNIDA--GRHVELIEAIANEYLEHALSQERDFPQWp----EDGAGQ 232 Agrobacteriu...
UoN:A3L23_04945 178 AWVLGDQHNFIASVAGLDCVLDWCATHSVTPEELANRDLttEVLDELAASMGGRYVEHGVLQQEIFLRT-----FGAPGV 252 Rhodococcus ...
P06524          159 LWNYPAARPILEDIDGYRCAIRFARKHDLAISQLPNIDA--GRHVELIEAIANEYLEHALSQERDFPQWp----EDGAGQ 232 Agrobacteriu...
P15653          158 LWREPRLRPILEGIDGYRYALLFATQNQITPDMLLQLDA--DMENKLIHGIAQEFLIHARRQEQKFPLVgatavEAFEGP 235 Agrobacteriu...
Q04590          159 VWKTTALRATLEGICGYRYAIEFAGKQGLEMDALTSLNR--RQLEQLVHGMAHEYLCYARQQEQELPLPs---lAGGEGP 233 Agrobacteriu...
Q47851          162 FFMNHKTIHPLEDIDGYRTIIDYCRCKKIGFDKLKIMTT--DQEKIIISGIAEEYYAHALWQEQETPCFp---hSWSRRW 236 Pantoea aggl...
P06619          159 AQSDLNAKLAIQDIDGYRYIMNYAQARRLSITQLLNVMTg-DMKEELINGIALEYYEHAKWQERDFPAE------WLAER 231 Pseudomonas ...
OYQ09840        162 LWAHPGNHAVLEDVDGYRQIIRYARASQVPIDRITSIDR--STMATLVERIAQEYWEHALWQEQEFLGIp---aTWRRAD 236 Ralstonia so...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap