Conserved Protein Domain Family
LFY_SAM

?
pfam01698: LFY_SAM 
Floricaula / Leafy protein SAM domain
This family consists of various plant development proteins which are homologs of floricaula (FLO) and Leafy (LFY) proteins which are floral meristem identity proteins. Mutations in the sequences of these proteins affect flower and leaf development. LFY proteins have been shown to binds semi-palindromic 19-bp DNA elements through its highly conserved C-terminal DBD. In addition to its well-characterized DBD, LFY possesses a second conserved domain at its amino terminus (LFY-N). This entry represents the SAM domain found in N -terminal of LFY proteins in plants. Crystallographic structure determination of LFY-N shows that LFY-N is a Sterile Alpha Motif (SAM) domain that mediates LFY oligomerization. It allows LFY to bind to regions lacking high-affinity LFYbs (LFY-binding sites) and confers on LFY the ability to access closed chromatin regions. Experiments carried out in plants, revealed that altering the capacity of LFY to oligomerize compromised its floral function and drastically reduced its genome-wide DNA binding. SAM oligomerization has been suggested to have a profound effect on a TF binding landscape by promoting cooperative binding of LFY to DNA, as was proposed for other oligomeric TFs, and it gives LFY access to closed chromatin regions that are notably refractory to TF binding. It has also been suggested that the biochemical properties of the SAM domain are evolutionary conserved in all plant species.
Statistics
?
PSSM-Id: 334642
View PSSM: pfam01698
Aligned: 10 rows
Threshold Bit Score: 124.868
Threshold Setting Gi: 1035489244
Created: 15-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q94IF4        39 SRRLKELFKDFGVQPSTVTVMGQMGFTLSTLINMKDEEVDFVIKSMIEEYHLDLLMGEQFGIKAAVRAKRRLVVEELE 116 Physcomitrella pa...
XP_017251743  46 LSGLEELFEPYGIRYFTAAKIGELGFTVNTLLNMKDQELDEMMTSLSHIFRWDLLVGERYGIKAAVRAERRRILEQYH 123 Daucus carota sub...
XP_002978027 100 AKTLDELFKDYGVRITTLAKMAEMGFTVQTLVNMTDQELEDVIKTMLEGYHVELLVGEKYGIKSAIRAERKHLEDDLE 177 Selaginella moell...
OAE20049      70 VRTLEDLFHGYGVRIATLAKMTEMGFTVSTLVNMTEAELDDVIQTISDILQMELLVGERYGIKSAVRAekkhleeele 147 Marchantia polymo...
ANJ12309      50 LGGLEGLFGPYGVRFYTAAKIAELGFTASTLVGMKDEELEDMMNSLSHIFRWELLVGERYGVKAAVRAERRRLQEEEE 127 Brassica juncea
XP_009405247  52 PRELEEVFSGYGVRYATVARIGELGFTASTLVGMTEAEVDDMMATLAHLFRWDLLLGERYGIKAALRAERRRLVDSRL 129 wild Malaysian ba...
XP_006844457  53 LGGLEDLFQQYGVRYFTVAKMVEMGFTVNTLVNMREEEIDEMMGSLGEIFRWELLMGERYGIKSAIRAERRRLEEEEA 130 Amborella trichopoda
KNA21572      87 SGGLEELFQAYGIRYYTAAKIAEMGFTVNTLVDMKEEEVDEMMNSLSHLFRWDLLVGERYGIKSAIRAERRRLEELEE 164 spinach
KRH63880      56 LGGLEELFQAYGIRYYTAAKIAELGFTVSTLVDMKDEELDDMMNSLSQIFRWDLLVGERYGIKAAVRAERRRVEDDDI 133 soybean
EPS61174      48 LGGLEELFQAYGIRYFTAAKIAELGFTVNTLLDMRDEELDEMMDSLSHIFRWDLLVGERYGIKAAVRAERRRLDEEea 125 Genlisea aurea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap