Conserved Protein Domain Family
IstB_IS21

?
pfam01695: IstB_IS21 
IstB-like ATP binding protein
This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.
Statistics
?
Aligned: 10 rows
Threshold Bit Score: 231.442
Threshold Setting Gi: 123453629
Created: 30-Apr-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAR52870           54 RRLERLLRAAKLKnPQACVEDIEYRQTRGLDQRIVA-TL-AGCDWVRNAQNLILTGPTGAGKTWLACAFGQQACR-QGFS 130 Burkholder...
P55500             61 RRIERHLAEAHLP-PGKTLESFAFDAVPMVSKAQVM-AIaAGDSWLAKGANILLFGPPGGGKSHLAAAIGLALIE-NGWR 137 Sinorhizob...
mgcchina:PST_0598  52 RSVSHQMNMAKLP-MHRDLASFDFNAS-SADARLIS-EL-ASLAFTDTAQNVVLIGGPGTGKTHLATALAVSGITrHGKR 127 Pseudomona...
Q0WFI1             48 RKQAMYTRMAAFP-AVKTFEEYDFTFATGAPQKQLQ-SL-RSLSFIERNENIVLLGPSGVGKTHLAIAMGYEAVR-AGIK 123 Yersinia p...
O69925             57 RRFRNGLRLSKLP-HHKTLEDYDFSFQPDLDPRKVK-DL-ATLSFIEDKANVALLGPPGVGKTHIAVALAVAACR-AGYS 132 Streptomyc...
MA:Aflv_2632       53 RSIQTLIKLSKLP-YRKTIDTFDFTAQPSVDERRIR-EL-LTLSFIDRKENILFLGPPGIGKTHLAISIGMEAIA-RGYK 128 Anoxybacil...
Q3L9G1             67 ANLHTRRKRAGFP-TGKTF--GDWDETKSSIPRATQdAL-RTLEWVGRRECFCVCGPSGTGKSHFTEALGQAAVE-AGLA 141 Rhodococcu...
P55380             59 KRIRNRLASAKLRfAQACIEDIDFAAARGLDRRNTM-AL-AQGQWLTAHEGLIITGHTGTGKSWLACAFGRQAAR-LGHS 135 Sinorhizob...
Q53200             54 KRLALRLRNAKLH-HPAVPEDIIRRAPREYDRTILD-LL-IAGDWIRKHENCAIVGPTGIGKSWLACALGHKACR-DNHS 129 Sinorhizob...
P55617             54 RKLAARLRFAKLR-HQAVPEDVDYRSERGLDRALFM-KL-IGGDWIDAHDNLAICGPSGVGKSWLACALGHKACR-DDRS 129 Sinorhizob...
CAR52870          131 VFYVRVARLFEELKIAHGDGSFTRRLAQLAKI-DVLILDDWGLQDLDQAARNDLLEVLDDRVGTRSTVITSQLPLEHWHA 209 Burkholder...
P55500            138 VLFTRTTDLVQKLQVARRELQLESAIAKLDKF-DLLILDDLAYVTKDQAETSVLFELISARYERRSIMITANQPFGEWNR 216 Sinorhizob...
mgcchina:PST_0598 128 VRFYSTVDLVNLLEREKHDGKAGRIAQALLRM-DLVILDELGYLPFSQAGGALLFHLLSKLYEHTSVVITTNLSFAEWSS 206 Pseudomona...
Q0WFI1            124 VRFTTAADLLLQLSTAQRQGRYKTTLQRGVMApRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQ 203 Yersinia p...
O69925            133 IYFTSLDDMVRHLKAAEDQGRLISKLTSYLRP-AVLVVDEVGYQPLERAEANLVFQVISKRYEKGSIILTSNKTFGEWGQ 211 Streptomyc...
MA:Aflv_2632      129 TYFITAHDLVNQLRRADQEGKLEKKLRVFVKP-TVLIIDEMGYLKLDPNSAHYLFQVIARRYEHAPIILTSNKSFGEWGE 207 Anoxybacil...
Q3L9G1            142 VSWFTIEDLGALVRRHRADDSIARALTRIIRS-DLIIVDDIGLLPVSEDAAEGLYRLVDAAYERRAIAVSSNLHPSGFDE 220 Rhodococcu...
P55380            136 VLYVRVPRMFEELALARLDGSFPRLIDRLTRV-QLLILDDFGTHTLSDQQRFHLFEIVEERYQRKSTLITAQVPVASWHD 214 Sinorhizob...
Q53200            130 VLYVRMPALLQSLEQARGIGSLATRLKSLGAV-ELLILDDYGLQPIDGNAPHYLLEILEGRYGRRSTLVTSQFPVARWHE 208 Sinorhizob...
P55617            130 VLYQRVPRLFANLALARGDGRYARLQRTLGHV-QLLILDDWGLEPLNEQARHDLLEILEDRYGRRSTIITSQLPVSAWHE 208 Sinorhizob...
CAR52870          210 WLQ-DPTLADAILDRLVHQAHK 230 Burkholderia cenocepacia J2315
P55500            217 VFP-DPAMTLAAVDRLVHHATI 237 Sinorhizobium fredii NGR234
mgcchina:PST_0598 207 VFG-DAKMTTALLDRLTHHChi 227 Pseudomonas stutzeri A1501
Q0WFI1            204 TFAgDAALTSAMLDRILHHSHV 225 Yersinia pestis
O69925            212 VFG-DEVLATAILDRLLHHCEV 232 Streptomyces coelicolor
MA:Aflv_2632      208 IVG-DSVLATAMLDRLLHHSII 228 Anoxybacillus flavithermus WK1
Q3L9G1            221 IMP--KTLATATVDRLLHHAHV 240 Rhodococcus erythropolis PR4
P55380            215 LIA-DSTVADAILDRIVHNAHR 235 Sinorhizobium fredii NGR234
Q53200            209 KIS-DPTYADAILDRLVHNAHR 229 Sinorhizobium fredii NGR234
P55617            209 IIG-NPTYADAILDRLVHNAHR 229 Sinorhizobium fredii NGR234
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap