Conserved Protein Domain Family
IstB_IS21

?
pfam01695: IstB_IS21 
IstB-like ATP binding protein
This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.
Statistics
?
PSSM-Id: 334641
View PSSM: pfam01695
Aligned: 10 rows
Threshold Bit Score: 231.057
Threshold Setting Gi: 123453629
Created: 17-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P55500        61 RRIERHLAEAHLP-PGKTLESFAFDAVPMVSKAQVM-AIaAGDSWLAKGANILLFGPPGGGKSHLAAAIGLALI-ENGWR 137 Sinorhizobium f...
Q0WFI1        48 RKQAMYTRMAAFP-AVKTFEEYDFTFATGAPQKQLQ-SL-RSLSFIERNENIVLLGPSGVGKTHLAIAMGYEAV-RAGIK 123 Yersinia pestis
O69925        57 RRFRNGLRLSKLP-HHKTLEDYDFSFQPDLDPRKVK-DL-ATLSFIEDKANVALLGPPGVGKTHIAVALAVAAC-RAGYS 132 Streptomyces co...
Q3L9G1        67 ANLHTRRKRAGFP-TGKTF--GDWDETKSSIPRATQdAL-RTLEWVGRRECFCVCGPSGTGKSHFTEALGQAAV-EAGLA 141 Rhodococcus ery...
P55380        59 KRIRNRLASAKLRfAQACIEDIDFAAARGLDRRNTM-AL-AQGQWLTAHEGLIITGHTGTGKSWLACAFGRQAA-RLGHS 135 Sinorhizobium f...
Q53200        54 KRLALRLRNAKLH-HPAVPEDIIRRAPREYDRTILD-LL-IAGDWIRKHENCAIVGPTGIGKSWLACALGHKAC-RDNHS 129 Sinorhizobium f...
P55617        54 RKLAARLRFAKLR-HQAVPEDVDYRSERGLDRALFM-KL-IGGDWIDAHDNLAICGPSGVGKSWLACALGHKAC-RDDRS 129 Sinorhizobium f...
WP_034065924   2 RSVSHQMNMAKLP-MHRDLASFDFNAS-SADARLIS-EL-ASLAFTDTAQNVVLIGGPGTGKTHLATALAVSGItRHGKR 77  Pseudomonas aer...
KPC97154      30 RSIQTLIKLSKLP-YRKTIDTFDFTAQPSVDERRIR-EL-LTLSFIDRKENILFLGPPGIGKTHLAISIGMEAI-ARGYK 105 Geobacillus sp....
WP_006397350  54 RRLERLLRAAKLKnPQACVEDIEYRQTRGLDQRIVA-TL-AGCDWVRNAQNLILTGPTGAGKTWLACAFGQQAC-RQGFS 130 Burkholderia
P55500       138 VLFTRTTDLVQKLQVARRELQLESAIAKLDKF-DLLILDDLAYVTKDQAETSVLFELISARYERRSIMITANQPFGEWNR 216 Sinorhizobium f...
Q0WFI1       124 VRFTTAADLLLQLSTAQRQGRYKTTLQRGVMApRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQ 203 Yersinia pestis
O69925       133 IYFTSLDDMVRHLKAAEDQGRLISKLTSYLRP-AVLVVDEVGYQPLERAEANLVFQVISKRYEKGSIILTSNKTFGEWGQ 211 Streptomyces co...
Q3L9G1       142 VSWFTIEDLGALVRRHRADDSIARALTRIIRS-DLIIVDDIGLLPVSEDAAEGLYRLVDAAYERRAIAVSSNLHPSGFDE 220 Rhodococcus ery...
P55380       136 VLYVRVPRMFEELALARLDGSFPRLIDRLTRV-QLLILDDFGTHTLSDQQRFHLFEIVEERYQRKSTLITAQVPVASWHD 214 Sinorhizobium f...
Q53200       130 VLYVRMPALLQSLEQARGIGSLATRLKSLGAV-ELLILDDYGLQPIDGNAPHYLLEILEGRYGRRSTLVTSQFPVARWHE 208 Sinorhizobium f...
P55617       130 VLYQRVPRLFANLALARGDGRYARLQRTLGHV-QLLILDDWGLEPLNEQARHDLLEILEDRYGRRSTIITSQLPVSAWHE 208 Sinorhizobium f...
WP_034065924  78 VRFYSTVDLVNLLEREKHDGKAGRIAQALLRM-DLVILDELGYLPFSQAGGALLFHLLSKLYEHTSVVITTNLSFAEWSS 156 Pseudomonas aer...
KPC97154     106 TYFITAHDLVNQLRRADQEGKLEKKLRVFVKP-TVLIIDEMGYLKLDPNSAHYLFQVIARRYEHAPIILTSNKSFGEWGE 184 Geobacillus sp....
WP_006397350 131 VFYVRVARLFEELKIAHGDGSFTRRLAQLAKI-DVLILDDWGLQDLDQAARNDLLEVLDDRVGTRSTVITSQLPLEHWHA 209 Burkholderia
P55500       217 VFP-DPAMTLAAVDRLVHHATI 237 Sinorhizobium fredii NGR234
Q0WFI1       204 TFAgDAALTSAMLDRILHHSHV 225 Yersinia pestis
O69925       212 VFG-DEVLATAILDRLLHHCEV 232 Streptomyces coelicolor
Q3L9G1       221 IMP--KTLATATVDRLLHHAHV 240 Rhodococcus erythropolis PR4
P55380       215 LIA-DSTVADAILDRIVHNAHR 235 Sinorhizobium fredii NGR234
Q53200       209 KIS-DPTYADAILDRLVHNAHR 229 Sinorhizobium fredii NGR234
P55617       209 IIG-NPTYADAILDRLVHNAHR 229 Sinorhizobium fredii NGR234
WP_034065924 157 VFG-DAKMTTALLDRLTHHCHI 177 Pseudomonas aeruginosa
KPC97154     185 IVG-DSVLATAMLDRLLHHSII 205 Geobacillus sp. BCO2
WP_006397350 210 WLQ-DPTLADAILDRLVHQAHK 230 Burkholderia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap