Conserved Protein Domain Family
Herpes_env

?
pfam01673: Herpes_env 
Herpesvirus putative major envelope glycoprotein
This family consists of probable major envelope glycoproteins from members of the herpesviridae including herpes simplex virus, human cytomegalovirus and varicella-zoster virus. Members of the herpesviridae have a dsDNA genome and do not have a RNA stage during there replication.
Statistics
?
Aligned: 5 rows
Threshold Bit Score: 613.801
Threshold Setting Gi: 82013952
Created: 18-Mar-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9E6N7  44 LFNELLLSAHALKINs----iQDVQSDDTVED------------------------------------------------ 71  Marek's disease herpe...
P09282  51 LFSELLFASHLINVP------RAIENNVTYEA------------------------------------------------ 76  Human herpesvirus 3 s...
P10216  46 LCAELLTASHVIGVPpvgtldEDVAADVVTAP------------------------------------------------ 77  Human alphaherpesviru...
Q6UDJ9  41 lSDELLYAAHLIQIP-----------DLEQQP------------------------------------------------ 61  Psittacid herpesvirus...
Q6SW79  66 LTTELLWHAHPRQVPmdealaAAAAASYQVNPqhpanryrhyefqtlslgtsevdellnccaeettcggtqstvltnatn 145 Human herpesvirus 5 s...
Q9E6N7  72 AGDIGNEV---------------------IHSELVTFIETAADV---------YALDRQCLVCRVLDMYRRNFGLSALWM 121 Marek's disease herpe...
P09282  77 SSAVGVDNe--------------------MTSSTTEFIEEIGDV---------LALDRACLVCRTLDLYKRKFGLTPEWV 127 Human herpesvirus 3 s...
P10216  78 SRARGGAGdgggsggrggprnpppdpcgeGLLDTGPFSAAAIDT---------FALDRPCLVCRTIELYKQTYRLSPQWV 148 Human alphaherpesviru...
Q6UDJ9  62 -SDCGEDEdga----------------gdGHDETDSFAEMIANI---------YTLDRACGVCQVLSEYRKKFPLKVEWM 115 Psittacid herpesvirus...
Q6SW79 146 TTSCGGAVagssnagp-----agasaacdLDAELAGLETSAADFeqlrrlcapLAIDTRCNLCAIISICLKQ-DCDQSWL 219 Human herpesvirus 5 s...
Q9E6N7 122 ADYAFLCSKCLGSPPCATATFIAAFEFVYIMDKHFLSDHGCTLVRSFGKKLLTLEDIQRHFFLHGCFR-TDGGVPGRRhd 200 Marek's disease herpe...
P09282 128 ADYAMLCMKSLASPPCAVVTFSAAFEFVYLMDRYYLCRYNVTLVGSFARRTLSLLDIQRHFFLHVCFR-TDGGLPGIR-- 204 Human herpesvirus 3 s...
P10216 149 ADYAFLCAKCLGAPHCAASIFVAAFEFVYVMDRHFLRTKKATLVGSFARFALTINDIHRHFFLHCCFR-TDGGVPGRHaq 227 Human alphaherpesviru...
Q6UDJ9 116 ADYALLCHKTQAAPLCATTTFVTAFEFAFIMDKHYLPAHGASMVGEFGRRNLFLADVQKHFFLNGCFTpVEGGLV----- 190 Psittacid herpesvirus...
Q6SW79 220 LEYSLLCFKCSYAPRAALSTLIIMSEFTHLLQQHF---SDLRIDDLFRHHVLTVFDFHLHFFINRCFEkQVG-------- 288 Human herpesvirus 5 s...
Q9E6N7 201 evitsrSKQGRlvgrrgkfstagdAKVLYSNYSYLAQSATRALLMTLSDLGSAPLE--------------VIEGRQKsis 266 Marek's disease herpe...
P09282 205 ------PPPGKem----------aNKVRYSNYSFFVQAVVRAALLSISTSRLDETEtrksfy---fnqdgLTGGPQP--- 262 Human herpesvirus 3 s...
P10216 228 kqpkpsPSPGA-------------AKVQYSNYSFLAQSATRALIGTLASGgeeg------------agsaAGSGTQPs-- 280 Human alphaherpesviru...
Q6UDJ9 191 ------------------------SKIDLNNYSFLVQSVARYAVTSFEGAKSSSWQpncgaagqqarhapAGHGKQMawa 246 Psittacid herpesvirus...
Q6SW79 289 ------------------------DAVDNENVTLNHLAVVRAMVMge--------------------------------- 311 Human herpesvirus 5 s...
Q9E6N7 267 gdvrnelrdgiesrkrvahvihsvgpvhscpttLSVALAGWKDCAKNVECNFFQ-----LE--------------SCTLR 327 Marek's disease herpe...
P09282 263 ---------------------------------LAAALANWKDCARMVDCSSSEhrtsgMI--------------TCAER 295 Human herpesvirus 3 s...
P10216 281 ---------------------------------LTTALMNWKDCARLLDC--TEgrrggGD--------------SCCTR 311 Human alphaherpesviru...
Q6UDJ9 247 ggatvatrgp-----------gdstwnspktssTAVALLKWREYARPLEC-FGKrrhrgLKrsaadadsagaismTCVQV 314 Psittacid herpesvirus...
Q6SW79 312 -----------------------------------------------dtVPYNKprrhpQQ----------------KQK 328 Human herpesvirus 5 s...
Q9E6N7 328 ASSEDNDYEHEWELRASEEKLnvvenvqdmqqidasqcehheharnEDCTMGYGNLVLLLLAGTgSAPEAA--------- 398 Marek's disease herpe...
P09282 296 ALKEDIEFEDILIDKLKKSSY-------------------------VEAAWGYADLALLLLSGV-ATWNVD--------- 340 Human herpesvirus 3 s...
P10216 312 AAARNGEFETVAGDREPEES---------------------------PDTWAYADLVLLLLAGTpAVWESG--------- 355 Human alphaherpesviru...
Q6UDJ9 315 AEAEDFARERELVDRAEYPAAqcaag----------------aamqCPSKWRFADLTALLMAGTaSLPARV--------- 369 Psittacid herpesvirus...
Q6SW79 329 NNPYHVEVPQELIDNFLEHS--------------------------SPSRDRFVQLLFYMWAGTgVMSTTPltelthtkf 382 Human herpesvirus 5 s...
Q9E6N7 399 SELAfMAAK--------VRRETVDIFWKNHRREFA-----NDVTAAYSACYG---EDSEPDLELGPLMITQLKHAITKGG 462 Marek's disease herpe...
P09282 341 ERTN-CAIE--------TRVGCVKSYWQANRIENS-----RDVPKQFSKFTS---EDACPEVAFGPILLTTLKNAKCRGR 403 Human herpesvirus 3 s...
P10216 356 PQLR-AAAE--------ARRATVRQSWEAHRGART-----RDVAPRFAQFTE---PDAQPDLDLGPLMATVLKHGRGRGR 418 Human alphaherpesviru...
Q6UDJ9 370 AESS-GATEcpiheiaaARQATVREY--HDRVAEVimseqNDRGREPPRFWG---RAAKPAAALGPILASVLPHPNGRGG 443 Psittacid herpesvirus...
Q6SW79 383 ARLDaLSTA--------SEREDARMMMEEEEDEEGgekggDDPGRHNGGGTSggfSESTLKKNVGPIYLCPVPAFFTKNQ 454 Human herpesvirus 5 s...
Q9E6N7 463 TSAECLLCNLLLIRTY-WLAMRKFKRDIITYSANNIGLFHSIEPVLDAWRSQGHRT---DLGDEGC-------------- 524 Marek's disease herpe...
P09282 404 TNTECMLCCLLTIGHY-WIALRQFKRDILAYSANNTSLFDCIEPVINAWSLDNPIKlkfPFNDEGR-------------- 468 Human herpesvirus 3 s...
P10216 419 TGGECLLCNLLLVRAY-WLALRRLRASVVRYSENNTSLFDCIVPVVDQLEADPETQ----PGDGGR-------------- 479 Human alphaherpesviru...
Q6UDJ9 444 TGGECLLCNLMLTEDY-WRAIRLLKSKVVGREDTNTSLFDGVQPSVDQFEEYANTA------DGGR-------------- 502 Psittacid herpesvirus...
Q6SW79 455 TSTVCLLCELMACSYYdNVVLRELYRRVVSYCQNNVKMVDRIQLVLADLLRECTSPlgaAHEDVARcgleaptspggdsd 534 Human herpesvirus 5 s...
Q9E6N7 525 -----------------FVTLMKSAGTEAIYKHLFCDPMCAARIAQTNPRSLFDHPDATNHDELALYKARLASQNHFEGR 587 Marek's disease herpe...
P09282 469 -----------------FITIVKAAGSEAVYKHLFCDLLCALSELQTNPKILFAHPTTADKEVLELYKAQLAAQNRFEGR 531 Human herpesvirus 3 s...
P10216 480 -----------------FVSLLRAAGPEAIFKHMFCDPMCAITEMEVDPWVLFGHPPATHPDELLLHKAKLACGNEFEGR 542 Human alphaherpesviru...
Q6UDJ9 503 -----------------MLTLLKSVGPNAIYKHLFCDPLCAINALRISPDVLWGSPP-SDPEAAELYKAELAARPNFSER 564 Psittacid herpesvirus...
Q6SW79 535 yhglsgvdgalarpdpvFCHVLRQAGVTGIYKHFFCDPQCAGNIRVTNEAVLFGH---LHPHHVQEVKLAICHDNYYISR 611 Human herpesvirus 5 s...
Q9E6N7 588 VCAGLWALAYTFKTYQVFPPR---PTALSAFVKDAGALLQRHSISLISLEHTLGVYV 641 Marek's disease herpesvirus type 1 strain MD5
P09282 532 VCAGLWTLAYAFKAYQIFPRK---PTANAAFIRDGGLMLRRHAISLVSLEHTLSKYV 585 Human herpesvirus 3 strain Dumas
P10216 543 VCIALRALIYTFKTYQVFVPK---PTALATFVREAGALLRRHSISLLSLEHTLCTYV 596 Human alphaherpesvirus 1 strain 17
Q6UDJ9 565 VCRGVWILAFAFKAYQLAPPR---PTALSTFIRSAESYLKRHGLNCIALEHALTRYV 618 Psittacid herpesvirus 1 Amazon parrot/1997
Q6SW79 612 LPRRVWLCITLFKAFQITKRTykgKVHLADFMRDFTQLLENCDIKLVDPTYVIDKYV 668 Human herpesvirus 5 strain Merlin
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap