1QXF


Conserved Protein Domain Family
Ribosomal_S27e

?
pfam01667: Ribosomal_S27e 
Click on image for an interactive view with Cn3D
Ribosomal protein S27
Statistics
?
Aligned: 8 rows
Threshold Bit Score: 84.8148
Threshold Setting Gi: 1710753
Created: 30-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1QXF_A    1 MHSRFVKVKCPDCEHEQVIFDHPSTIVKCIICGRTVAEPTGGKGNIKAEIIEYVD 55  Archaeoglobus fulgidus
EDP00546 30 PNSFFMDVKCQGCFNITTVFSHSQTVVMCGSCSSVLCTPTGGRARLTEGCSFRRK 84  Chlamydomonas reinhardtii
P42677   28 PNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRK 82  human
AAA29118 29 PNSYFLEIKCPKCGATTTTFSHAHRQILCQKCGQPLGQPTGGKLKLTQQCKFRIK 83  Entamoeba histolytica
P54028    8 PRTKFLRVQCPECNNEQIVFGSPATVVKCLTCGKVLVEPRGGKGKVKAKILEILG 62  Methanocaldococcus jannaschii DSM 2661
O27364    9 TKGNFLRVKCLDCGNQQVVFDRAASYVQCIICGKTLVEPTGGKSKIKAQILEVLD 63  Methanothermobacter thermautotrophicus str. D...
O28935    1 MHSRFVKVKCPDCEHEQVIFDHPSTIVKCIICGRTVAEPTGGKGNIKAEIIEYVD 55  Archaeoglobus fulgidus DSM 4304
P35997   28 PRSYFLDVKCPGCLNITTVFSHAQTAVTCESCSTILCTPTGGKAKLSEGTSFRRK 82  Saccharomyces cerevisiae S288C
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap