2X47,5CB3,5FUD,5KIV,1YD9,2DX6,2XD7,1HJZ,5M3I,3EJF,2ACF


Conserved Protein Domain Family
Macro

?
pfam01661: Macro 
Click on image for an interactive view with Cn3D
Macro domain
This domain is an ADP-ribose binding module. It is found in a number of otherwise unrelated proteins. It is found at the C-terminus of the macro-H2A histone protein. This domain is found in the non-structural proteins of several types of ssRNA viruses such as NSP3 from alphaviruses. This domain is also found on its own in a family of proteins from bacteria, archaebacteria and eukaryotes.
Statistics
?
PSSM-Id: 366746
View PSSM: pfam01661
Aligned: 99 rows
Threshold Bit Score: 77.6193
Threshold Setting Gi: 218511763
Created: 30-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2X47_A   80 VNAANSSLLG-----GGGVDGCIHRAAGPLLTDECRTL----QsCKTGKAKITGGYRLPakYVIHTvgPIAYgePSASQA 150  human
Q5FWR2  213 VHPTSSDLYT-----GGEVGNALEKKGGKEFVEAVTELkkknGpLDIAGAAVSSGHGLPakFVIHCnsPSW---GSDKCE 284  tropical clawed frog
Q02874  215 INPTNADIDL-----KDDLGSTLEKKGGKEFVEAVLELrkknGpLEVAGAAVSAGHGLPakFVIHCnsPVW---GADKCE 286  Norway rat
Q9P0M6  216 VHPTTAEIDL-----KEDIGKALEKAGGKEFLETVKELrksqGpLEVAEAAVSQSSGLAakFVIHChiPQW---GSDKCE 287  human
Q8IKY5  114 VNGTNKVFELmkegnGYDCSGNFLKTCGDELLNDMKNAkeqnKg---KSIILTKGYNSSykHIIHVvePYY------NQT 184  Plasmodium falcipar...
P0C6Y1 1040 VNAANEHMTH-----GSGVAKAIADFCGLDFVEYCEDYvkkhGp---QQRLVTPSFVKGiqCVNNVvgPRH---GDNNLH 1108 Avian infectious br...
P0C6X9 1344 VNPANGRMAH-----GAGVAGAIAEKAGSAFIKETSDMvkaqGvCQVGECYESAGGKLCk-KVLNIvgPDARg-HGKQCY 1416 Murine hepatitis vi...
1YD9_A   37 VHPTNTDFYI-----GGEVGSTLEKKGGKEFVEAVLELrkknGpLEVAGAAVSAGHGLPakFVIHCnsPVW---GSDKCE 108  Norway rat
2XD7_A   40 VHPTTAEIDL-----KEDIGKALEKAGGKEFLETVKELrksqGpLEVAEAAVSQSSGLAakFVIHChiPQW---GSDKCE 111  human
3EJF_A   40 VNAANEHMTH-----GSGVAKAIADFCGLDFVEYCEDYvkkhGpQQ---RLVTPSFVKGiqCVNNVvgPRH---GDNNLH 108  Infectious bronchit...
2X47_A  151 AELRSCYLSSLDLLLEHRLRSVAFPCISTGVFGYPCEAAAEI 192  human
Q5FWR2  285 ELLEKTVKNCLALADEKKIKSIAFPSIGSGRNGFPKQTAAQL 326  tropical clawed frog
Q02874  287 ELLEKTVKNCLALADDRKLKSIAFPSIGSGRNGFPKQTAAQL 328  Norway rat
Q9P0M6  288 EQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQV 329  human
Q8IKY5  185 QKLKNCYENILLTAKDNNFKNIVFPLLGSGISLFKKHDVVIS 226  Plasmodium falciparum 3D7
P0C6Y1 1109 EKLVAAYKNV----LVDGVVNYVVPVLSLGIFGVDFKMSIDA 1146 Avian infectious bronchitis virus (strain Beaudette)
P0C6X9 1417 SLLERAYQHI----NKCD--NVVTTLISAGIFSVPTDVSLTY 1452 Murine hepatitis virus strain A59
1YD9_A  109 ELLEKTVKNCLALADDRKLKSIAFPSIGSGRNGFPKQTAAQL 150  Norway rat
2XD7_A  112 EQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQV 153  human
3EJF_A  109 EKLVAAYKNVL----VDGVVNYVVPVLSLGIFGVDFKMSIDA 146  Infectious bronchitis virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap