1NW1,3FI8,4R77,3LQ3


Conserved Protein Domain Family
Choline_kinase

?
pfam01633: Choline_kinase 
Click on image for an interactive view with Cn3D
Choline/ethanolamine kinase
Choline kinase catalyzes the committed step in the synthesis of phosphatidylcholine by the CDP-choline pathway. This alignment covers the protein kinase portion of the protein. The divergence of this family makes it very difficult to create a model that specifically predicts choline/ethanolamine kinases only. However if pfam01633 is also present then it is definitely a member of this family.
Statistics
?
PSSM-Id: 307660
View PSSM: pfam01633
Aligned: 34 rows
Threshold Bit Score: 159.758
Threshold Setting Gi: 12644534
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1NW1_B 104 EPNKVLLRVYFNP-ETESHLVAESVIFTLLSERHLGPKLYGIFSGGRLE--EYI-PSRPLSCHEISLAHMSTKIAKRVAK 179 Caenorhabditis elegans
Q03764 155 NLPPLLMRIFGDSiDSVIDREYELKVIARLSFYDLGPKLEGFFENGRFE--KYIeGSRTSTQADFIDRDTSIKIAKKLKE 232 Saccharomyces cerevis...
Q10276  86 HAPKLLLRIYGPHvELFINRQVELENLKRLARHNIGPYLIGEFSNGRFE--QYM-ESTTLTCKTIRDPKLSIYVGRRLCE 162 Schizosaccharomyces p...
P20485 168 KLPSLLLRIYGPNiDNIIDREYELQILARLSLKNIGPSLYGCFVNGRFE--QFLeNSKTLTKDDIRNWKNSQRIARRMKE 245 Saccharomyces cerevis...
P46558  63 SATPYLLRIHRQG---PSHVFMDTVNFAIFSERGLGPKLYGFFDGGRME--EFL-PSRTLDSDCILDPEISRRVGAVYPK 136 Caenorhabditis elegans
P46560  63 SATSFVLRIHREG---QSQFDTDIVNFAIFSERGLGPKLYGFFEEGRME--EFL-PSVTLKLNDVLNTEISRKIGAAFPK 136 Caenorhabditis elegans
Q7RT78 137 IRKHILFRIYGKDvGELYNTDIEIEVYETMSKYKISPKLLNTFSGGRIE--EWL-YGNPLKTEDLQNSKILIAIANMLGK 213 Plasmodium yoelii yoelii
3FI8_A  57 TRRHVLFRIYGKDvDALYNPLSEFEVYKTMSKYRIAPLLLNTFDGGRIE--EWL-YGDPLSIDDLKNKSILVGIANVLGK 133 Plasmodium falciparum...
Q98BZ0 155 AAGKHVVRFGQDYpFHHVFREREVMTARAAHAAGFAPAVHYSEPGILVT--QFL-GARTFLAEDVRA--NLGRVAALLRS 229 Mesorhizobium loti
P71392  11 sgVKFVLRIPNAVnLSLINREYEAFNNAQAYRAGLNVETPVLDAKSGVKltRYLeNSNTLSQIQLNEQSCLSQVVNNLYR 90  Haemophilus influenza...
1NW1_B 180 VHQLEVp-----iWKEPDYLCEALQRWlkq---ltGTVDAEHRFDLPEECGVSSVNCLDLARELEFLRAHI-S------- 243 Caenorhabditis elegans
Q03764 233 LHCTVPlth--keITDQPSCWTTFDQWik----liDSHKEWVSNNVNISENLRCSSWNFFLKSFKNYKRWLyNdsaftsk 306 Saccharomyces cerevis...
Q10276 163 LHNFILlhp--heVLEMPAAWKNCLVW--------LPKAKAKILGRKHSLAITSEFMKTLEEDFNAYYNWFvEws----- 227 Schizosaccharomyces p...
P20485 246 LHVGVPlls--seRKNGSACWQKINQWlr----tiEKVDQWVGDPKNIENSLLCENWSKFMDIVDRYHKWLiSqe----- 314 Saccharomyces cerevis...
P46558 137 YHAIDVp------VSKKRRCFQVMRESlkeyqdlgGGDYEIKPTTVTYSEHPKKISMDDLYKEIDFMEKWTnE------- 203 Caenorhabditis elegans
P46560 137 YHAINVp------VSKSRRCFQIMRESlhdyqalgGGDFAIFPTVVTYSEHPKSISIKDLLTEIDLLEKWSiD------- 203 Caenorhabditis elegans
Q7RT78 214 FHTLAIkktlpshWDKTPCIYKRIQEW-----------------------KIQLSKLKNIDKFKGDINKYYqEsdkfikf 270 Plasmodium yoelii yoelii
3FI8_A 134 FHTLSRkrhlpehWDKTPCVFKMMDRW-----------------------RLAVSNYKNLDKVTLDINKYIqEshkflkf 190 Plasmodium falciparum...
Q98BZ0 230 FHREMPnhv--sgAGFMFWVFHVIRDY------------ARTLEEGNSRKRSDLPRLLTLADELERAQKLLp-------- 287 Mesorhizobium loti
P71392  91 LHNSEFv------FRNVFSVFDEFRQYfsl---leNKSAFYQADSRMDKLSAVFWQFEEINKEVI--------------- 146 Haemophilus influenza...
1NW1_B 244 --------LSKSP---VTFCHNDLQEGNILLpkassgnirmpsls------------------detqalgnslsafNPAD 294 Caenorhabditis elegans
Q03764 307 llreddkdSMINSglkMVFCHNDLQHGNLLFksk---------------------------------------gkdDISV 347 Saccharomyces cerevis...
Q10276 228 ------rdKKDWFglkMVFSHNDTQYGNLLKikakk-----------------------------------rsiplSQKH 266 Schizosaccharomyces p...
P20485 315 -------qGIEQVnknLIFCHNDAQYGNLLFtapvmntpslytapsstsltsqssslfpsssnvivddiinppkqeQSQD 387 Saccharomyces cerevis...
P46558 204 --------LFEDT---VVFCHNDLASSNILE---------------------------------------------LNST 227 Caenorhabditis elegans
P46560 204 --------LFENT---LVFCHNDLTSSNILQ---------------------------------------------LNST 227 Caenorhabditis elegans
Q7RT78 271 mnkytkedSIRNH---ITFCHNDLQENNIIN-----------------------------------------------TN 300 Plasmodium yoelii yoelii
3FI8_A 191 ikiytqieNIAND---IVFCHNDLQENNIMN-----------------------------------------------TN 220 Plasmodium falciparum...
Q98BZ0 288 ----------------IVFGHNDLLPANILD-----------------------------------------------DG 304 Mesorhizobium loti
P71392 147 ----------------LRPCHNDLVPENMLL-----------------------------------------------QD 163 Haemophilus influenza...
1NW1_B 295 PRLVLIDFEYASYNYRAFDFANHFIEWTIDYDIDeapf--ykiQTENFPENDQ 345 Caenorhabditis elegans
Q03764 348 GDLTIIDFEYAGPNPVVFDLSNHLNEWMQDYNDVqsf----ksHIDKYPKEED 396 Saccharomyces cerevisiae S288c
Q10276 267 RTLVPVDFEYAGPNLCAFDLANYFAEWMADYHHPthn---ylmDRSRYPDFNA 316 Schizosaccharomyces pombe 972h-
P20485 388 SKLVVIDFEYAGANPAAYDLANHLSEWMYDYNNAkap---hqcHADRYPDKEQ 437 Saccharomyces cerevisiae S288c
P46558 228 KELVLIDWEFGSYNCRGFDLAMHLAETAADFRDStppg--iriSEELTDNPPN 278 Caenorhabditis elegans
P46560 228 GELVFIDWENASYNWRGYDLAMHLSEAAV-IRNTcppg--iviNEELTDNPPN 277 Caenorhabditis elegans
Q7RT78 301 NCLRLIDFEYAGYNFIATDIAIFFIETSIDYSTDtypf--yeiNKNQYISYEK 351 Plasmodium yoelii yoelii
3FI8_A 221 KCLRLIDFEYSGYNFLSADIANFFIETTIDYSYNaypf--fiiNKKNYISYES 271 Plasmodium falciparum 3D7
Q98BZ0 305 NRLWLIDFEYAGFNTAMFDLAGVASNAGMSDEESfa------fLTAYFMKEPD 351 Mesorhizobium loti
P71392 164 DRLFFIDWEYSGLNDPLFDIATIIEEAHLSKEAAdflletycnQTNKYHKtef 216 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap