1NW1,3FI8,4R77,3LQ3


Conserved Protein Domain Family
Choline_kinase

?
pfam01633: Choline_kinase 
Click on image for an interactive view with Cn3D
Choline/ethanolamine kinase
Choline kinase catalyzes the committed step in the synthesis of phosphatidylcholine by the CDP-choline pathway. This alignment covers the protein kinase portion of the protein. The divergence of this family makes it very difficult to create a model that specifically predicts choline/ethanolamine kinases only. However if pfam01633 is also present then it is definitely a member of this family.
Statistics
?
PSSM-Id: 307660
View PSSM: pfam01633
Aligned: 34 rows
Threshold Bit Score: 159.758
Threshold Setting Gi: 12644534
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1NW1_B       104 EPNKVLLRVYFNP-ETESHLVAESVIFTLLSERHLGPKLYGIFSGGRLE--EYI-PSRPLSCHEISLAHMSTKIAKRVAK 179
gi 6685418   155 NLPPLLMRIFGDSiDSVIDREYELKVIARLSFYDLGPKLEGFFENGRFE--KYIeGSRTSTQADFIDRDTSIKIAKKLKE 232
gi 1730048    86 HAPKLLLRIYGPHvELFINRQVELENLKRLARHNIGPYLIGEFSNGRFE--QYM-ESTTLTCKTIRDPKLSIYVGRRLCE 162
gi 125401    168 KLPSLLLRIYGPNiDNIIDREYELQILARLSLKNIGPSLYGCFVNGRFE--QFLeNSKTLTKDDIRNWKNSQRIARRMKE 245
gi 45645008   63 SATPYLLRIHRQG---PSHVFMDTVNFAIFSERGLGPKLYGFFDGGRME--EFL-PSRTLDSDCILDPEISRRVGAVYPK 136
gi 152031629  63 SATSFVLRIHREG---QSQFDTDIVNFAIFSERGLGPKLYGFFEEGRME--EFL-PSVTLKLNDVLNTEISRKIGAAFPK 136
gi 74884153  137 IRKHILFRIYGKDvGELYNTDIEIEVYETMSKYKISPKLLNTFSGGRIE--EWL-YGNPLKTEDLQNSKILIAIANMLGK 213
3FI8_A        57 TRRHVLFRIYGKDvDALYNPLSEFEVYKTMSKYRIAPLLLNTFDGGRIE--EWL-YGDPLSIDDLKNKSILVGIANVLGK 133
gi 81778316  155 AAGKHVVRFGQDYpFHHVFREREVMTARAAHAAGFAPAVHYSEPGILVT--QFL-GARTFLAEDVRA--NLGRVAALLRS 229
gi 12644534   11 sgVKFVLRIPNAVnLSLINREYEAFNNAQAYRAGLNVETPVLDAKSGVKltRYLeNSNTLSQIQLNEQSCLSQVVNNLYR 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1NW1_B       180 VHQLEVp-----iWKEPDYLCEALQRWlkq---ltGTVDAEHRFDLPEECGVSSVNCLDLARELEFLRAHI-S------- 243
gi 6685418   233 LHCTVPlth--keITDQPSCWTTFDQWik----liDSHKEWVSNNVNISENLRCSSWNFFLKSFKNYKRWLyNdsaftsk 306
gi 1730048   163 LHNFILlhp--heVLEMPAAWKNCLVW--------LPKAKAKILGRKHSLAITSEFMKTLEEDFNAYYNWFvEws----- 227
gi 125401    246 LHVGVPlls--seRKNGSACWQKINQWlr----tiEKVDQWVGDPKNIENSLLCENWSKFMDIVDRYHKWLiSqe----- 314
gi 45645008  137 YHAIDVp------VSKKRRCFQVMRESlkeyqdlgGGDYEIKPTTVTYSEHPKKISMDDLYKEIDFMEKWTnE------- 203
gi 152031629 137 YHAINVp------VSKSRRCFQIMRESlhdyqalgGGDFAIFPTVVTYSEHPKSISIKDLLTEIDLLEKWSiD------- 203
gi 74884153  214 FHTLAIkktlpshWDKTPCIYKRIQEW-----------------------KIQLSKLKNIDKFKGDINKYYqEsdkfikf 270
3FI8_A       134 FHTLSRkrhlpehWDKTPCVFKMMDRW-----------------------RLAVSNYKNLDKVTLDINKYIqEshkflkf 190
gi 81778316  230 FHREMPnhv--sgAGFMFWVFHVIRDY------------ARTLEEGNSRKRSDLPRLLTLADELERAQKLLp-------- 287
gi 12644534   91 LHNSEFv------FRNVFSVFDEFRQYfsl---leNKSAFYQADSRMDKLSAVFWQFEEINKEVI--------------- 146
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1NW1_B       244 --------LSKSP---VTFCHNDLQEGNILLpkassgnirmpsls------------------detqalgnslsafNPAD 294
gi 6685418   307 llreddkdSMINSglkMVFCHNDLQHGNLLFksk---------------------------------------gkdDISV 347
gi 1730048   228 ------rdKKDWFglkMVFSHNDTQYGNLLKikakk-----------------------------------rsiplSQKH 266
gi 125401    315 -------qGIEQVnknLIFCHNDAQYGNLLFtapvmntpslytapsstsltsqssslfpsssnvivddiinppkqeQSQD 387
gi 45645008  204 --------LFEDT---VVFCHNDLASSNILE---------------------------------------------LNST 227
gi 152031629 204 --------LFENT---LVFCHNDLTSSNILQ---------------------------------------------LNST 227
gi 74884153  271 mnkytkedSIRNH---ITFCHNDLQENNIIN-----------------------------------------------TN 300
3FI8_A       191 ikiytqieNIAND---IVFCHNDLQENNIMN-----------------------------------------------TN 220
gi 81778316  288 ----------------IVFGHNDLLPANILD-----------------------------------------------DG 304
gi 12644534  147 ----------------LRPCHNDLVPENMLL-----------------------------------------------QD 163
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|...
1NW1_B       295 PRLVLIDFEYASYNYRAFDFANHFIEWTIDYDIDeapf--ykiQTENFPENDQ 345
gi 6685418   348 GDLTIIDFEYAGPNPVVFDLSNHLNEWMQDYNDVqsf----ksHIDKYPKEED 396
gi 1730048   267 RTLVPVDFEYAGPNLCAFDLANYFAEWMADYHHPthn---ylmDRSRYPDFNA 316
gi 125401    388 SKLVVIDFEYAGANPAAYDLANHLSEWMYDYNNAkap---hqcHADRYPDKEQ 437
gi 45645008  228 KELVLIDWEFGSYNCRGFDLAMHLAETAADFRDStppg--iriSEELTDNPPN 278
gi 152031629 228 GELVFIDWENASYNWRGYDLAMHLSEAAV-IRNTcppg--iviNEELTDNPPN 277
gi 74884153  301 NCLRLIDFEYAGYNFIATDIAIFFIETSIDYSTDtypf--yeiNKNQYISYEK 351
3FI8_A       221 KCLRLIDFEYSGYNFLSADIANFFIETTIDYSYNaypf--fiiNKKNYISYES 271
gi 81778316  305 NRLWLIDFEYAGFNTAMFDLAGVASNAGMSDEESfa------fLTAYFMKEPD 351
gi 12644534  164 DRLFFIDWEYSGLNDPLFDIATIIEEAHLSKEAAdflletycnQTNKYHKtef 216
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap