3FI8,1NW1,4R7B


Conserved Protein Domain Family
Choline_kinase

?
pfam01633: Choline_kinase 
Click on image for an interactive view with Cn3D
Choline/ethanolamine kinase
Choline kinase catalyzes the committed step in the synthesis of phosphatidylcholine by the CDP-choline pathway. This alignment covers the protein kinase portion of the protein. The divergence of this family makes it very difficult to create a model that specifically predicts choline/ethanolamine kinases only. However if pfam01633 is also present then it is definitely a member of this family.
Statistics
?
Aligned: 31 rows
Threshold Bit Score: 168.991
Threshold Setting Gi: 12644534
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3FI8_A  57 TRRHVLFRIYGKDVDALYNPLSEFEVYKTMSKYRIAPLLLNTFDGGRIE--EWL-YGDPLSIDDLKNKSILVGIANVLGK 133 Plasmodium falciparum...
O81024  86 KEVSVTVRLYGPNTEYVINREREILAIKYLSAAGFGAKLLGGFGNGMVQ--SFI-NARTLEPSDMREPKIAAQIARELGK 162 thale cress
Q7RRB3 127 EKKIYLIRLYGPKTSEIINRGREQIISNILNNKNISKKIYVFFPNGRIE--EFM-EGYALSKEEIKNPKFQKEIAKNLKT 203 Plasmodium yoelii yoelii
P71392  11 sgVKFVLRIPNAVNLSLINREYEAFNNAQAYRAGLNVETPVLDAKSGVKltRYLeNSNTLSQIQLNEQSCLSQVVNNLYR 90  Haemophilus influenza...
Q86MJ6  60 GTEHVIFRVFGHNTNKVIDRENEVIAWKQLAEYGFAAPLYGKFNNGLIC--GFL-EGKSLAIEQMRDSKFNMNIAKRIAQ 136 Caenorhabditis elegans
Q7SGC3  97 DKEAILLRAYGNGTDLIIDRHRETQNHELLMRYGLAPELLARFENGMMY--RFV-QGSMTHPEDLRKPVIYKAVAKRLAQ 173 Neurospora crassa
P54352 223 SDNVVLVRIYGNKTDLLIDRKAETQNFLLLHTYGLAPSLYATFKNGLVY--EYV-PGTTLNTDSVLCPEIWPLVARRMAE 299 fruit fly
Q9D4V0  71 meDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCY--EFI-QGEALDPQHVCNPAIFRLIARQLAK 147 house mouse
Q554D8  75 SNKSVIIRLYGKGSEQFIDRKTEANIQYLLSKNGVGPKFYGTFENGCIY--GYV-EGDQLQLEDLYQNNILSLIAKETGR 151 Dictyostelium discoideum
Q869T9  70 RYLPVVIRLYGYKSEEIIDRKNELIIQTEADQNGLGAKFYGLFDNGCIY--GFI-KGEPLAYEDISKPTMQTCIAKEIAQ 146 Dictyostelium discoideum
3FI8_A 134 FHTLSRkrh--------------------------------------------------lpeHWDKTPCVFKMMDRW--- 160 Plasmodium falciparum...
O81024 163 FHKVDI--------------------------------------------------------PGSKEPQLWVDILKFyek 186 thale cress
Q7RRB3 204 LHDIELnedvyqtikklqted--------------------------ciyykdlkynnnsdqINNRSSFLWGTIWKYfnl 257 Plasmodium yoelii yoelii
P71392  91 LHNSEF--------------------------------------------------------VFRNVFSVFDEFRQYfsl 114 Haemophilus influenza...
Q86MJ6 137 LHSSVP---------------------------------------------------------TNGKTPVFEKMRTFlqq 159 Caenorhabditis elegans
Q7SGC3 174 WHAVVPcitartghsrrnskntdfi------------------vpsealgdaefqqiidsvaPGKPPPNVWTVMQKWifa 235 Neurospora crassa
P54352 300 MHRKVRkhg--------------------------------------------------dssATKPMPMIWKKTQSFldl 329 fruit fly
Q9D4V0 148 IHAIHAh------------------------------------------------------nGWIPKSNLWLKMGKYfsl 173 house mouse
Q554D8 152 WHSLKLdinsnsqlllssssdssikesttistststststsstspstspslenstlsprnmnTQTSSTSLFKNLNSWinn 231 Dictyostelium discoideum
Q869T9 147 WHSIEM--------------------------------------------------------PTRKNPSLWPTIKKWaal 170 Dictyostelium discoideum
3FI8_A 161 -----------------RLAVSNYKNLDKVTLDINKYIqEshkflkfikiytqieNIAND---IVFCHNDLQENNIMN-- 218 Plasmodium falciparum...
O81024 187 astlt----feepdkqkLFETISFEELHKEIIELREFT-G---------------LLNAP---VVFAHNDLLSGNFMLn- 242 thale cress
Q7RRB3 258 lyeeknk-pcdfdskvnILKLIDFESLKKTISEIEKLC-K---------------EKKSP---VVLCHCDLLSSNFINk- 316 Plasmodium yoelii yoelii
P71392 115 lenksafyqadsrmdklSAVFWQFEEINKEVI-------------------------------LRPCHNDLVPENMLL-- 161 Haemophilus influenza...
Q86MJ6 160 lnpsf-----ekesqqnFFHENFPTDLGAEISKIEKMI-V---------------MLKEP---IVFCHNDLLVHNIVYd- 214 Caenorhabditis elegans
Q7SGC3 236 l------------ptdtEAQRERQAQLQKELTRTVAELsQ---------------RPGLGtngLVFAHCDLLSGNVIVlp 288 Neurospora crassa
P54352 330 vperfs---daekhkrvKETFLPIGRLREEFNKLYEYL-E---------------ALDSP---IVFSHNDLLLGNVIYt- 386 fruit fly
Q9D4V0 174 iptgfa---deninkrfLSEIPSPQLLQEEMTWMKELL-S---------------SLGSP---VVLCHNDLLCKNIIYn- 230 house mouse
Q554D8 232 amtlt-----skeskgsMISKINLNRYKEEAMSLMSFI-E---------------EHYSGeeyINFCHNDLIPRNMIYn- 289 Dictyostelium discoideum
Q869T9 171 apdvy-----pvpekneYYQSINVKKMIEEGKMLEQRL-A---------------QLNSP---IVFCHNDLLSGNIIYd- 225 Dictyostelium discoideum
3FI8_A 219 -----------------TNKCLRLIDFEYSGYNFLSADIANFFIETTIDYSYNAYp-FFII-NKKNYISYES 271 Plasmodium falciparum 3D7
O81024 243 ----------------dEEEKLYLIDFEYGSYNYRGFDIGNHFNEYAG----------YDC-DYSLYPSKEE 287 thale cress
Q7RRB3 317 -----------------TDNTICLIDFEYSCPMERAFDIANHFNEYAG----------FNC-EWNLIPTRAE 360 Plasmodium yoelii yoelii
P71392 162 -----------------QDDRLFFIDWEYSGLNDPLFDIATIIEEAHLSKEAADFllETYCnQTNKYHKtef 216 Haemophilus influenzae Rd KW20
Q86MJ6 215 ----------------sEKKSIEFIDYEYAFPNYALYDIANHFCEYAGVEGSP---------DYSKCLTKDE 261 Caenorhabditis elegans
Q7SGC3 289 kpqqtpaddsngvtakdTTIDVTFIDYEYATPSPAAFDIANHFAEWGG----------FDC-DFSVLPTRVQ 349 Neurospora crassa
P54352 387 ----------------qSLNTVNFIDYEYADYNFQAFDIGNHFAEMCGV---------DEV-DYSRYPKREF 432 fruit fly
Q9D4V0 231 ----------------eKQGDVQFIDYEYSGYNYLAYDIGNHFNEFAG---------VSDV-DYSLYPDREl 276 house mouse
Q554D8 290 ----------------kEKGQVKFIDFEYSGYNFRGYDIGNFFCEFSG----------LDL-DYTKYPSIEI 334 Dictyostelium discoideum
Q869T9 226 ----------------pSQNCASFIDFEYANYNFRGLELGNHFNEYAG----------FGP-DYSLYPNKES 270 Dictyostelium discoideum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap