3LQ3,2CKO,1NW1,4R77


Conserved Protein Domain Family
Choline_kinase

?
pfam01633: Choline_kinase 
Click on image for an interactive view with Cn3D
Choline/ethanolamine kinase
Choline kinase catalyzes the committed step in the synthesis of phosphatidylcholine by the CDP-choline pathway. This alignment covers the protein kinase portion of the protein. The divergence of this family makes it very difficult to create a model that specifically predicts choline/ethanolamine kinases only. However if pfam01633 is also present then it is definitely a member of this family.
Statistics
?
PSSM-Id: 366735
View PSSM: pfam01633
Aligned: 36 rows
Threshold Bit Score: 160.138
Threshold Setting Gi: 12644534
Created: 30-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3LQ3_A 103 EPREVLLRLYGAILQGVDSLVLESVMFAILAERSLGPQLYGVFPEGRLE--QYI-PSRPLKTQELREPVLSAAIATKMAQ 179 human
Q86MJ6  60 GTEHVIFRVFGHNTNKVIDRENEVIAWKQLAEYGFAAPLYGKFNNGLIC--GFL-EGKSLAIEQMRDSKFNMNIAKRIAQ 136 Caenorhabditis elegans
Q9D4V0  71 meDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCY--EFI-QGEALDPQHVCNPAIFRLIARQLAK 147 house mouse
Q554D8  75 SNKSVIIRLYGKGSEQFIDRKTEANIQYLLSKNGVGPKFYGTFENGCIY--GYV-EGDQLQLEDLYQNNILSLIAKETGR 151 Dictyostelium discoideum
Q869T9  70 RYLPVVIRLYGYKSEEIIDRKNELIIQTEADQNGLGAKFYGLFDNGCIY--GFI-KGEPLAYEDISKPTMQTCIAKEIAQ 146 Dictyostelium discoideum
O81024  86 KEVSVTVRLYGPNTEYVINREREILAIKYLSAAGFGAKLLGGFGNGMVQ--SFI-NARTLEPSDMREPKIAAQIARELGK 162 thale cress
Q98BZ0 155 AAGKHVVRFGQDYPFHHVFREREVMTARAAHAAGFAPAVHYSEPGILVT--QFL-GARTFLAEDVRA--NLGRVAALLRS 229 Mesorhizobium loti
P71392  11 sgVKFVLRIPNAVNLSLINREYEAFNNAQAYRAGLNVETPVLDAKSGVKltRYLeNSNTLSQIQLNEQSCLSQVVNNLYR 90  Haemophilus influenza...
Q8IIB7 131 HQNKYLIRLYGPKTSEIINREREKLISNILCDKNISKKIYVFFPNGRIE--EFK-DGYALSREDIKNKDFQKEIAENLRI 207 Plasmodium falciparum...
Q7RRB3 127 EKKIYLIRLYGPKTSEIINRGREQIISNILNNKNISKKIYVFFPNGRIE--EFM-EGYALSKEEIKNPKFQKEIAKNLKT 203 Plasmodium yoelii yoelii
3LQ3_A 180 FHGMEMp-------------------------------------------------------fTKEPHWLFGTMERYl-- 202 human
Q86MJ6 137 LHSSVP---------------------------------------------------------TNGKTPVFEKMRTFlq- 158 Caenorhabditis elegans
Q9D4V0 148 IHAIHAhn------------------------------------------------------gWIPKSNLWLKMGKYfsl 173 house mouse
Q554D8 152 WHSLKLdinsnsqlllssssdssikesttistststststsstspstspslenstlsprnmntQTSSTSLFKNLNSWin- 230 Dictyostelium discoideum
Q869T9 147 WHSIEMp--------------------------------------------------------TRKNPSLWPTIKKWaa- 169 Dictyostelium discoideum
O81024 163 FHKVDIp--------------------------------------------------------GSKEPQLWVDILKFye- 185 thale cress
Q98BZ0 230 FHREMPnhv----------------------------------------------------sgAGFMFWVFHVIRDY--- 254 Mesorhizobium loti
P71392  91 LHNSEFv--------------------------------------------------------FRNVFSVFDEFRQYfsl 114 Haemophilus influenza...
Q8IIB7 208 LHDIQLddtiykkl------------------------------------------qalqniqGNRSSFLWSTLWKYfnt 245 Plasmodium falciparum...
Q7RRB3 204 LHDIELnedvyqtikklqtedc--------------------------iyykdlkynnnsdqiNNRSSFLWGTIWKYfnl 257 Plasmodium yoelii yoelii
3LQ3_A 203 -----KQIQDLPPTGLPEMNLLEMYSLKDEMGNLRKLLESTPSP---VVFCHNDIQEGNILLLSEpenADSLMLVDFEYS 274 human
Q86MJ6 159 ----qLNPSFEKESQQNFFHENFPTDLGAEISKIEKMIVMLKEP---IVFCHNDLLVHNIVYDSE---KKSIEFIDYEYA 228 Caenorhabditis elegans
Q9D4V0 174 ---ipTGFADENINKRFLSEIPSPQLLQEEMTWMKELLSSLGSP---VVLCHNDLLCKNIIYNEK---QGDVQFIDYEYS 244 house mouse
Q554D8 231 ----nAMTLTSKESKGSMISKINLNRYKEEAMSLMSFIEEHYSGeeyINFCHNDLIPRNMIYNKE---KGQVKFIDFEYS 303 Dictyostelium discoideum
Q869T9 170 ----lAPDVYPVPEKNEYYQSINVKKMIEEGKMLEQRLAQLNSP---IVFCHNDLLSGNIIYDPS---QNCASFIDFEYA 239 Dictyostelium discoideum
O81024 186 ---kaSTLTFEEPDKQKLFETISFEELHKEIIELREFTGLLNAP---VVFAHNDLLSGNFMLNDE---EEKLYLIDFEYG 256 thale cress
Q98BZ0 255 ------ARTLEEGNSRKRSDLPRLLTLADELERAQKLLp--------IVFGHNDLLPANILD--D---GNRLWLIDFEYA 315 Mesorhizobium loti
P71392 115 lenksAFYQADSRMDKLSAVFWQFEEINKEVI---------------LRPCHNDLVPENMLL--Q---DDRLFFIDWEYS 174 Haemophilus influenza...
Q8IIB7 246 l-keeRQKKYSFNPKAYILKLIDFDMLESIITEIQELCCKKNSP---VVLCHCDLLSSNIIK-TE---GSSISFIDFEYS 317 Plasmodium falciparum...
Q7RRB3 258 l-yeeKNKPCDFDSKVNILKLIDFESLKKTISEIEKLCKEKKSP---VVLCHCDLLSSNFIN-KT---DNTICLIDFEYS 329 Plasmodium yoelii yoelii
3LQ3_A 275 SYNYRGFDIGNHFCEWVYDYTHEewpf--ykaRPTDYPTQEQ 314 human
Q86MJ6 229 FPNYALYDIANHFCEYAGVEGSP---------DYSKCLTKDE 261 Caenorhabditis elegans
Q9D4V0 245 GYNYLAYDIGNHFNEFAGvs----------dvDYSLYPDREl 276 house mouse
Q554D8 304 GYNFRGYDIGNFFCEFSGld-----------lDYTKYPSIEI 334 Dictyostelium discoideum
Q869T9 240 NYNFRGLELGNHFNEYAGfg-----------pDYSLYPNKES 270 Dictyostelium discoideum
O81024 257 SYNYRGFDIGNHFNEYAGyd-----------cDYSLYPSKEE 287 thale cress
Q98BZ0 316 GFNTAMFDLAGVASNAGMSDEESfa------fLTAYFMKEPD 351 Mesorhizobium loti
P71392 175 GLNDPLFDIATIIEEAHLSKEAAdflletycnQTNKYHKtef 216 Haemophilus influenzae Rd KW20
Q8IIB7 318 CPMERAYDIANHFNEYAGfn-----------cEWDLTPNRSE 348 Plasmodium falciparum 3D7
Q7RRB3 330 CPMERAFDIANHFNEYAGfn-----------cEWNLIPTRAE 360 Plasmodium yoelii yoelii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap