3CBG


Conserved Protein Domain Family
Methyltransf_3

?
pfam01596: Methyltransf_3 
Click on image for an interactive view with Cn3D
O-methyltransferase
Members of this family are O-methyltransferases. The family includes catechol o-methyltransferase, caffeoyl-CoA O-methyltransferase and a family of bacterial O-methyltransferases that may be involved in antibiotic production.
Statistics
?
PSSM-Id: 307638
View PSSM: pfam01596
Aligned: 5 rows
Threshold Bit Score: 324.85
Threshold Setting Gi: 81816533
Created: 14-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3CBG_A        30 SISAD--DSFYLAQLRRETAHLP--GAPMQISPEQAQFLGLLISLTGAKQVLEIGVFRGYSALAMALQLPPDGQIIACDQ 105
gi 81816533   15 EHSSE--LHPILEELVEFTYKNTd-LPQMMVGRAEGNFLKMLVEISGAKRVLEIGTFTGFSALMMAQGLPEDGKLTTIEV 91
gi 30580369   22 ETSAYprEHELLKELRKATVQKYgnLSEMEVPVDEGHFLSMLVKIMNAKNTIEIGVFTGYSLLTTALALPEDGRITAIDI 101
gi 118484246  35 ETSVYprEPECMKELREVTAKHP--WNIMTTSADEGQFLNMLLKLVNAKNTMEIGVYTGYSLLATALAIPEDGKILAMDI 112
gi 224101913  22 ETSAYpgEHEQLKELREATTKKYgsLSEMSVPVDEGRFLSMLLKLMNAKRTLEVGVFTGYSLLSTALALPEDGQVTAIDK 101
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3CBG_A       106 DPNATAIAKKYWQKAGVAEKISLRLGPALATLEQLTQGKpl-peFDLIFIDADKRNYPRYYEIGLNLLRRGGLMVIDNVL 184
gi 81816533   92 NPEYAQMAKSFIERAPWGKKIEVIVGDARKVLEEFKKES-----FDFIFIDADKSSYPYYYEKCLELLKKGRLMAIDNAL 166
gi 30580369  102 DKEAYEVGLEFIKKAGVDHKINFIHSDGLKALDQLVNDKc---eFDFAFADADKSSYVNFHERLLKLVKVGGIIAFDNTL 178
gi 118484246 113 NRENYELGLPVIQKAGVAHKIDFKEGPALPVLDQMIEDGkchgsFDFIFVDADKDNYINYHKRLIELVKVGGLIGYDNTL 192
gi 224101913 102 DREAYEIGLPFIQKAGVEEKINFIQSEATPILNEMLSNDkq-peFDFAFVDADKSSYKHYHEQLLKLVKIGGIIAYDNTL 180
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|...
3CBG_A       185 WHGKVTEV-DPQEAQTQVl-----qQFNRDLAQDERVRISVIPLGDGMTLALK 231
gi 81816533  167 WEGKVLEP-DDNRSKAIA-------RMNEMIKEDPRVEKVLLTVRDGIFLVRK 211
gi 30580369  179 WFGFVAED-EDGVPEHMReyraaliEFNKKLALDPRVEVSQISIGDGITLCRR 230
gi 118484246 193 WNGSVVAPpDAPMRKYVRyyrdfvlELNKALAADPRIEICMLPVGDGITLCRR 245
gi 224101913 181 WYGLVAKEvDDEAPELLRmvrtvimEFNKLLSSDPRVEISQISIGDGVTLCRR 233
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap