5CB6,2GKS,4RFV,2OFW


Conserved Protein Domain Family
APS_kinase

?
pfam01583: APS_kinase 
Click on image for an interactive view with Cn3D
Adenylylsulphate kinase
Enzyme that catalyzes the phosphorylation of adenylylsulphate to 3'-phosphoadenylylsulfate. This domain contains an ATP binding P-loop motif.
Statistics
?
PSSM-Id: 307631
View PSSM: pfam01583
Aligned: 18 rows
Threshold Bit Score: 222.956
Threshold Setting Gi: 7387881
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5CB6_A    24 RGVTIWLTGLSGAGKTTITHALEKKLRDSG-YRLEVLDGDVVRTNLTKGLGFSKEDRDTNIRRIGFVSHLLTRNGVIVLV 102 Synechocystis sp. P...
P13442   459 LPAVLWFTGLSGSGKSTIANELDRILHAQG-KHTYLLDGDNVRHGLNRDLGFTEEDRVENIRRVAEVAKLMADAGLIVLV 537 Sinorhizobium melil...
Q985Q4   462 RPAVFWFTGLSGSGKSTIANLFEKKLFATG-RHTYILDGDNVRHGLNRDLGFTDADRVENIRRVAEVAKLMADAGLIVIV 540 Mesorhizobium loti
O06735    26 KSCVLWFTGLSGSGKSVLANAVDEKLYRKG-IQSYVLDGDNIRHGLNKDLGFQTGDRIENIRRIGEVAKLFVDSGQMILT 104 Bacillus subtilis s...
O34577    25 KSSILWLTGLSGSGKSTIANAAARELFEQG-YQVIVLDGDNIRHGLNRDLGFSDEDRKENIRRIGEVAKLFVQQGTIVIT 103 Bacillus subtilis s...
O50274   464 QPATVLFSGLSGAGKSTLAYAVERKLFDMG-RAVYVLDGQNLRHDLNKGLPQDRAGRTENWLRTAHVAKQFNEAGLISLC 542 Pseudomonas aerugin...
P0A6J1    27 RGVVLWFTGLSGSGKSTVAGALEEALHKLG-VSTYLLDGDNVRHGLCSDLGFSDADRKENIRRVGEVANLMVEAGLVVLT 105 Escherichia coli K-12
Q12555   395 QGFTIFLTGYMNSGKDAIARALQVTLNQQGgRSVTLLLGDTVRHELSSELGFSREDRHTNVQRIAFVAGELTRAGAAVIA 474 Aspergillus nidulan...
2GKS_B   371 QGFCVWLTGLPCAGKSTIAEILATMLQARG-RKVTLLDGDVVRTHLSRGLGFSKEDRITNILRVGFVASEIVKHNGVVIC 449 Aquifex aeolicus
CCD04015 465 RPAVLWFTGLSGAGKSTVANRVERLLHALG-HHTMMLDGDNVRLGLNRDLGFTDADRVENVRRVGEVAKLMTDAGLIVLC 543 Azospirillum brasil...
5CB6_A   103 SAISPYAAIRQEVKHTIGD----FLEVFVNAPLAVCEERDVKGLYAKARSGEIKGFTGIDDPYEPPTNPDVECRtDL 175 Synechocystis sp. PCC ...
P13442   538 SFISPFRDERRMARELMEEg--eFIEIFVDTPLDECARRDPKGLYEKALAGKIANFTGVSSCYEAPENPELHIR-TV 611 Sinorhizobium meliloti...
Q985Q4   541 SFISPFSAERRMARELMADg--eFIEVFVDTPFEECARRDPKGLYARALNGEIKNFTGVDSPYQAPEHPEIHLKtlg 615 Mesorhizobium loti
O06735   105 AFISPFREDRDMVRALFPKg--eFFEIYVKCPLHVCEQRDPKGLYKKARNGEIKHFTGIDSPYEAPLSPDFIIEsDQ 179 Bacillus subtilis subs...
O34577   104 AFISPFREDRQQVRELVEAg--eFNEVYIKCDLDICEQRDPKGLYKKARNGEIPFFTGIDSPYEEPEAPELVLDsGQ 178 Bacillus subtilis subs...
O50274   543 AFVAPSAEGREQARALIGae--rLITVYVQASPQVCRERDPQGLYAAGED----NIPGESFPYDVPLDADLVIDtQA 613 Pseudomonas aeruginosa...
P0A6J1   106 AFISPHRAERQMVRERVGEg--rFIEVFVDTPLAICEARDPKGLYKKARAGELRNFTGIDSVYEAPESAEIHLN-GE 179 Escherichia coli K-12
Q12555   475 APIAPYEHSRKAAREAVQStggsFFLVHVNTPLEYCEATDKRGIYAKARRGEIKGFTGVDDPYEAPTNANLVVDvSK 551 Aspergillus nidulans F...
2GKS_B   450 ALVSPYRSARNQVRNMMEEg--kFIEVFVDAPVEVCEERDVKGLYKKAKEGLIKGFTGVDDPYEPPVAPEVRVDtTK 524 Aquifex aeolicus
CCD04015 544 AFIAPFRAEREAVRALLPEg--aFLEVFVDTPLEECVRRDPKGLYAKARSGALKNFTGVDSPYEPPIAPELRLDtAA 618 Azospirillum brasilens...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap