4BZP,5CB6,2GKS,1M8P


Conserved Protein Domain Family
APS_kinase

?
pfam01583: APS_kinase 
Click on image for an interactive view with Cn3D
Adenylylsulphate kinase
Enzyme that catalyzes the phosphorylation of adenylylsulphate to 3'-phosphoadenylylsulfate. This domain contains an ATP binding P-loop motif.
Statistics
?
Aligned: 22 rows
Threshold Bit Score: 224.482
Threshold Setting Gi: 27065625
Created: 24-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4BZP_A   4 RGKTVWFTGLSGSGKSSVAMLVERKLLEKG-ISAYVLDGDNLRHGLNADLGFSMADRAENLRRLSHVATLLADCGHLVLV 82  Mycobacterium tubercu...
O06735  26 KSCVLWFTGLSGSGKSVLANAVDEKLYRKG-IQSYVLDGDNIRHGLNKDLGFQTGDRIENIRRIGEVAKLFVDSGQMILT 104 Bacillus subtilis sub...
O34577  25 KSSILWLTGLSGSGKSTIANAAARELFEQG-YQVIVLDGDNIRHGLNRDLGFSDEDRKENIRRIGEVAKLFVQQGTIVIT 103 Bacillus subtilis sub...
O29953   1 MSFVIWITGPSGAGKTTLANALYKKLESMG-YRVELLDGDGVRRKLYPNLGFSEEERWMHNRVVVEMARRLSRNGIITIV 79  Archaeoglobus fulgidu...
P72940   4 RGVTIWLTGLSGAGKTTITHALEKKLRDSG-YRLEVLDGDVVRTNLTKGLGFSKEDRDTNIRRIGFVSHLLTRNGVIVLV 82  Synechocystis sp. PCC...
Q12555 395 QGFTIFLTGYMNSGKDAIARALQVTLNQQGgRSVTLLLGDTVRHELSSELGFSREDRHTNVQRIAFVAGELTRAGAAVIA 474 Aspergillus nidulans ...
O67174 371 QGFCVWLTGLPCAGKSTIAEILATMLQARG-RKVTLLDGDVVRTHLSRGLGFSKEDRITNILRVGFVASEIVKHNGVVIC 449 Aquifex aeolicus VF5
P9WNM5 442 RGKTVWFTGLSGSGKSSVAMLVERKLLEKG-ISAYVLDGDNLRHGLNADLGFSMADRAENLRRLSHVATLLADCGHLVLV 520 Mycobacterium tubercu...
5CB6_A  24 RGVTIWLTGLSGAGKTTITHALEKKLRDSG-YRLEVLDGDVVRTNLTKGLGFSKEDRDTNIRRIGFVSHLLTRNGVIVLV 102 Synechocystis sp. PCC...
2GKS_A 371 QGFCVWLTGLPCAGKSTIAEILATMLQARG-RKVTLLDGDVVRTHLSRGLGFSKEDRITNILRVGFVASEIVKHNGVVIC 449 Aquifex aeolicus
4BZP_A  83 PAISPLAEHRALARKVHADAgiDFFEVFCDTPLQDCERRDPKGLYAKARAGEITHFTGIDSPYQRPKNPDLRLTpD 158 Mycobacterium tuberculosis
O06735 105 AFISPFREDRDMVRALFPKG--EFFEIYVKCPLHVCEQRDPKGLYKKARNGEIKHFTGIDSPYEAPLSPDFIIEsD 178 Bacillus subtilis subsp. ...
O34577 104 AFISPFREDRQQVRELVEAG--EFNEVYIKCDLDICEQRDPKGLYKKARNGEIPFFTGIDSPYEEPEAPELVLDsG 177 Bacillus subtilis subsp. ...
O29953  80 SVVSPYRAWREYARKEIEK----FVEVYPRCPLEVRMKRDPKGLYSKALRGEIKGLTGLDGEYEEPENPEVVVDtD 151 Archaeoglobus fulgidus DS...
P72940  83 SAISPYAAIRQEVKHTIGD----FLEVFVNAPLAVCEERDVKGLYAKARSGEIKGFTGIDDPYEPPTNPDVECRtD 154 Synechocystis sp. PCC 680...
Q12555 475 APIAPYEHSRKAAREAVQSTggSFFLVHVNTPLEYCEATDKRGIYAKARRGEIKGFTGVDDPYEAPTNANLVVDvS 550 Aspergillus nidulans FGSC A4
O67174 450 ALVSPYRSARNQVRNMMEEg--KFIEVFVDAPVEVCEERDVKGLYKKAKEGLIKGFTGVDDPYEPPVAPEVRVDtT 523 Aquifex aeolicus VF5
P9WNM5 521 PAISPLAEHRALARKVHADAgiDFFEVFCDTPLQDCERRDPKGLYAKARAGEITHFTGIDSPYQRPKNPDLRLTpd 596 Mycobacterium tuberculosi...
5CB6_A 103 SAISPYAAIRQEVKHTIGD----FLEVFVNAPLAVCEERDVKGLYAKARSGEIKGFTGIDDPYEPPTNPDVECRtD 174 Synechocystis sp. PCC 680...
2GKS_A 450 ALVSPYRSARNQVRNMMEEG--KFIEVFVDAPVEVCEERDVKGLYKKAKEGLIKGFTGVDDPYEPPVAPEVRVDtT 523 Aquifex aeolicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap