Conserved Protein Domain Family
Myosin_tail_1

?
pfam01576: Myosin_tail_1 
Myosin tail
The myosin molecule is a multi-subunit complex made up of two heavy chains and four light chains it is a fundamental contractile protein found in all eukaryote cell types. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament. The coiled-coil region provides the structural backbone the thick filament.
Statistics
?
Aligned: 17 rows
Threshold Bit Score: 1291.25
Threshold Setting Gi: 528503547
Created: 24-Apr-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6URW6        869 TRQDEVLQARAQELQKVQELQQQSAREVGELQGRVAQLEEERTRLAEQLRAEAELCSEAEETRARLAARKQELELVVTEL 948  house mouse
AAI62152      846 TRQEEEMSLKEEELQKAKESAQKFEIELKDIALKHTQLMDERNQLQEKLQAETELYAEAEEMRVRLASKKQELEEILHEM 925  zebrafish
XP_023813027  844 TRQEEEMGQKEEELKAVREAAAKAEADLKDITQKHSQLVEEQAMLEAKLQAEAELYAEAEDMRVRLEAKKQELEEVLHEM 923  Japanese medaka
TDH03366      925 TRQEEEMGQKDEELKAAKEVAAKVETELKDITQKHTQLMEERAQLEMKLHAETELYAEAEEMRVRLEAKKQELEEVLHEM 1004 yellow perch
XP_005157988  908 TRQDEEIQAREAQLQKAKDKLSKLELDFTELDKKNQQLIEEKSVLTDQLQAEAELFAEAEEMRARLANRKQELEDVLGEL 987  zebrafish
XP_004916275  855 TRQDEVMQAKVVELQKVKDTQVKTESELKEMANKYQQLFEEKSILAEQLQAETELFAEAEEMRARLASKKQELEEILHDL 934  tropical claw...
XP_016851550  874 TRQDEVMQAKAVELQKVQEKHTKTQMDLKELENKYQQLSEEKTILAEQLQAETELFAEAEEMRARLAARKQELEDILHEL 953  green anole
XP_024840731  855 TRQEEEMQAKEDELQKTKERQQKAESELKELEQKHSQLTEEKNLLQEQLQAETELYAEAEEMRVRLAAKKQELEEILHEM 934  cattle
XP_025861267  908 TRQEEELQAKDEELLKVKERQTKVEGELEEMERKHQQLLEEKNILTEQLQAETELFAEAEEMRARLAAKKQELEEILHDL 987  red fox
CAG10783      945 TRQEEEMQAKDEELMKVKEKKLKVENELVEMERKHQQLLEEKNILAEQLHAETELFAEAEEMRVRLLTRKQELEEILHDL 1024 spotted green...
Q6URW6        949 EARVGEEEECSRQLQSEKKRLQQHIQELESHLEAEEGARQKLQLEKVTTEAKMKKFEEDLLLLEDQNSKLSKERRLLEER 1028 house mouse
AAI62152      926 EARLEEEEDRGAALQMEKKKMHEQIKDLEEHLEEEEDARQKLQLEKVTCDAKIKKLEDDILIMDDQNNKLQKERKILEER 1005 zebrafish
XP_023813027  924 EARLEEEEERSISLQQEKKEMEQELQLMEAHIVQEEDARQKLQLEKAAVEGRVKKLEENLLLSEDQNNKLQKERKLLEER 1003 Japanese medaka
TDH03366     1005 ESRLEEEEDRSNALHNERKEMEQQLQLMEAHIAEEEDARQKLQMEKVSVEGKVKKLEEDILMMEDQNNKLQKERKLLEER 1084 yellow perch
XP_005157988  988 ESRLEEEEERTVQLTNEKKRIQQHVQDLEEQLEEEEGTRQRLQLEKVTLESKVKSLEAETLTLAEQRDRLSKEKKQLEER 1067 zebrafish
XP_004916275  935 EARVEEEEERTLQLQNEKKKMHQHIQDLEEQLEEEEGARQKLQLEKVTTESRLKKMEEDILLLEDQNAKLAKERKLLDDR 1014 tropical claw...
XP_016851550  954 ESRVEEEEERCQQLQGDKKKMQQHVQDLEEQLEEEEAARQKLQLEKVSTEAKLKKMEEDLLVLEDQNSKLHKERKLMEER 1033 green anole
XP_024840731  935 EARLEEEEDRSQQLQAERKKMAQQMLDLEEQLEEEEAARQKLQLEKVTAEAKIKKLEDDILVMDDQNNKLSkERKLLEER 1014 cattle
XP_025861267  988 ESRVEEEEERNQILQNEKKKMQAHIQDLEEQLDEEEGARQKLQLEKVTAEAKIKKMEEEILLLEDQNSKFIKEKKLMEDR 1067 red fox
CAG10783     1025 ESRVEEEEERNQSLQNERKKMQAHIQDLEEQLDEEEAARQKLQLDKVTAEAKIKKMEEENLLLEDHNSKLLKEKKLLDDR 1104 spotted green...
Q6URW6       1029 LAEFSSQAAEEEEKVKSLNKLRLKYEATISDMEDRLKKEEKGRQELEKLKRRLDGESSELQEQMVEQKQRAEELLAQLGR 1108 house mouse
AAI62152     1006 IADFSSNLAEEEEKSKNLTKLKNKHESMISELEVRLKKEEKTRQELDKAKRKLEAESNDLQEQIADLQAQIADLKAQLAK 1085 zebrafish
XP_023813027 1004 LADMSSNLAEEEEKSKNLSKLKSKHESMISELEVRLKKEEKTRQDVEKAKRKVEAELVDLQEQQADLQAQLAELRAQLAA 1083 Japanese medaka
TDH03366     1085 LADMSSNLAEEEEKSKNLSKLKTKHESMISELELRMKKEEKGRLDMEKAKRKVEAELGDLQEQHADLQAQLAELRAQLAA 1164 yellow perch
XP_005157988 1068 LNEVTDQLTEEEEKVKSLNKLKNKQEAVIADIEERLKREEQGRLEQEKWKRRMEGEAVEAQEQLSDMSLLVTELRGSLSQ 1147 zebrafish
XP_004916275 1015 IGEFTSTMAEEEEKVKSLNKLRNKYEAVIADLEDRLKKEEKGRQEMEKMKRKLDGETTDLQDQLLELQQQIEELKQQLAR 1094 tropical claw...
XP_016851550 1034 LSEFTSHMAEEEEKVKSLSKLRNKYEAVMADMEDRLKKEEKGRQELEKLKRKLDGEAGDLQEQVAELQQQLEELRQALAR 1113 green anole
XP_024840731 1015 ISDLTTNLAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKLKRKLDGEASDLHEQIAELQAQIAELKMQLAK 1094 cattle
XP_025861267 1068 IAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKVQLAK 1147 red fox
CAG10783     1105 ISEVTSQLAEEEEKAKNLSKLKNKQELMIVDLEERLKKEEKTRQELEKAKRKLDSELSDLQEQITELQTQSQETRSQLAK 1184 spotted green...
Q6URW6       1109 KEDELQAALLRAEEEGGARAQLLKSLREAQAGLAEAQEDLEAERVARAKAEKQRRDLGEELEALRGELEDTLDSTNAQQE 1188 house mouse
AAI62152     1086 KEEELQAALARLEDETGQKNNALKKIRELEGHISDLQEDLESERAARNKAEKTKRDLGEELEALKSELEDTLDTTATQQE 1165 zebrafish
XP_023813027 1084 KEEELQTTQACLDEESRQRGAALKRVRDLEALLAELQEDLEAEKVARGKAEAARRDLGEELNSLRSELEDSLDTTAAQQE 1163 Japanese medaka
TDH03366     1165 KEEELQATQARLEEECNQRGAAVKRVRELEVLISELQEDLEAERAARGKVEAARRDLGEELNALRTELEDSLGTTAAQQE 1244 yellow perch
XP_005157988 1148 REKEITTLQTRLEEEGARRTEAQRALREAMSQVSELKEEVENERGMRERAEKQRRDLGEELEALRTELEDTLDTTAAQQE 1227 zebrafish
XP_004916275 1095 KEEELQAALARVDDEVGQKNNLLKQLRDLQSQLAELHEDLESEKAARAKAEKQRRDLGEELEALKTELEDTLDSTAAQQE 1174 tropical claw...
XP_016851550 1114 KEAELQAALARVEDEAAQKNAVLKSLRELQAQLAELQEDMESEKLARAKAEKQRRDLGEELEALKTELEDTLDSTAAQQE 1193 green anole
XP_024840731 1095 KEEELQAALGRLDDEMAQKNNALKKIRELEGHISDLQEDLDSERAARNKAEKQKRDLGEELEALKTELEDTLDSTATQQE 1174 cattle
XP_025861267 1148 KEEELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEALKTELEDTLDTTAAQQE 1227 red fox
CAG10783     1185 KEEETQAALCRSDEETAQKNIALKQVRELQAHLAELQEDLESEKTSRIKAEKLKRDLSEELEALKTELEDTLDTTAAQQE 1264 spotted green...
Q6URW6       1189 LRSKREQEVTELKKALEEESRAHEVSMQELRQRHSQALVEMAEQLEQARRGKGVWEKTRLSLEAEVSELKAELSSLQTSR 1268 house mouse
AAI62152     1166 LRAKREQEVTLLKRAIEDESRVHEAQVQEMRQKHTQALEELTEQLEQSKRVKVNLEKAKQALEKETSELHVELRSLTQGK 1245 zebrafish
XP_023813027 1164 LRVKREQEMAMLKKAMEDEGRSHETQIQELRQKHGQAVEELREHLEQAKKVRAALEKAKQALEKEAADLSADLRALSSTK 1243 Japanese medaka
TDH03366     1245 LRAKREQEVSMLKKAMEDEGRSHEAQVQDLRQKHSQAVEELTEQLEQAKRVRAGLEKAKQALEKESADLSADLRSLASAK 1324 yellow perch
XP_005157988 1228 LRSRREAELGELQRCLEEETRRHEAQLSELRIKHTAAIDSLQEQLDNAKRSRQSLEKAKAVLEEERLNLSAELKTLQGGK 1307 zebrafish
XP_004916275 1175 LRAKREQEVTDLKKTIEEDVKVRDAQVTEMRQRHNQVVEEISEQLEQARRFKGNLEKVKQTLESENTDLIKEVKNLQAAK 1254 tropical claw...
XP_016851550 1194 LRSKREQEVTELKKTIEEEVKVHEAQVLDMRQRHTSALEELSEQLEQSRRFKINLEKTKQALEGENAEMQKEVKLLQAAK 1273 green anole
XP_024840731 1175 LRAKREQEVTMLKKALDEETRSHESQVQEMRQKHTQVVEELTEQLEQFKRAKANLDKNKQALEKENAELAGELRVLSQAK 1254 cattle
XP_025861267 1228 LRTKREQEVAELKKALEEETRSHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVK 1307 red fox
CAG10783     1265 LRSKREQEVAELKKAIDEEARNHEAQIQEMRQRHTTALEELSDQLEQARRLKGSLEKNLQNLEGDNKELGTEVKSLQQAK 1344 spotted green...
Q6URW6       1269 QEGEQKRRRLESQLQEVQGRSSDSERARSEAAEKLQRAQAELESVSTALSEAESKAIRLGKELSSAESQLHDTQELLQEE 1348 house mouse
AAI62152     1246 QDVEHKKKKLEGQLADLQSRFNDSERHKAELGDRVSKITVELESVTNLLNEAEGKNIKLSKDVASLSSQVQDTQELLAEE 1325 zebrafish
XP_023813027 1244 QDVEQKKKKVEAQLNDLQLRFSESERQRNELSERVSKMTVELDSVTGLLNEAEGRNIKLSKEASSISSQLQDAQELLSEE 1323 Japanese medaka
TDH03366     1325 QDVEHKKKKVEGQLNELNSRFNESERQRTELGERVSKLTTELDSVTGLLNEAEGKNIKLSKDVSSLSSQLQDAQELLSEE 1404 yellow perch
XP_005157988 1308 MESERGRKRAEGQLQELNARLSQAEREREEREERLGKLQSELESLSSSLSSSDSKSHRLHKEVSSLESQLHDVQELLQEE 1387 zebrafish
XP_004916275 1255 QDSEQRRKKLEQQVSEFQIRTNESEKVKFELAEKLQKLQAELDGVSGALGSTEGKSIKLTKDLSTVQSQLQDTQELLQEE 1334 tropical claw...
XP_016851550 1274 LESEQRRKKLEGQVQELQLRAGEGERAKAELVERLVKLQNELDGVSGTLGSTESKTIKLAKDLATVESHLQDTQELLQEE 1353 green anole
XP_024840731 1255 QEVEHKKKKLEVQLQELQSKYSDGEKVRAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASLGSQLQDTQELLQEE 1334 cattle
XP_025861267 1308 AESEHKRKKLDAQVQELHAKVSEGDRLRVELAEKANKLQNELDNVSSLLEEAEKKGIKFAKDAASLESQLQDTQELLQEE 1387 red fox
CAG10783     1345 AESEYRRKKVEAQLQELLSRAAEAEKTKAELSERSHGLQVELDNVSASLEESETKGVKLAKEVEKLSSKLQDLEDLQQEE 1424 spotted green...
Q6URW6       1349 TRAKLALGSRVRALEAEAAGLREQMEEEVVARERAGRELQSTQA-----------------------QLSEWRRRQEEEA 1405 house mouse
AAI62152     1326 TRQKLQLSTKLRQIEDDRNALQEQLDEEAEAKRNVERHVSTLNI-----------------------QLSDFKKKLEEMT 1382 zebrafish
XP_023813027 1324 TRQKLNLSGRLRQLEEDKGCLMEQLEEEMEAKQAVERQASSLSV-----------------------QLSDLKKRLEELS 1380 Japanese medaka
TDH03366     1405 TRQKLNLSGRLRQTEEDRNSLMEQLEEETEAKRAVERQVSSLNM-----------------------QLSDSKKKLDEMS 1461 yellow perch
XP_005157988 1388 TRQKLALGSRVRALEEEKAGLMERLEEEEEKTRELTRQIQNHTQ-----------------------QLADLKRQTEEVN 1444 zebrafish
XP_004916275 1335 TRQKLNFSSRVRQLEEEKNNLMENLEEEESAKAQLSRQLQALQQ-----------------------QLLESKKRMEDQG 1391 tropical claw...
XP_016851550 1354 TRQKLNLSSRVRQLEEEKAAMLEQLEEEEAAKANFSRQMQSLQQ-----------------------QVMETKKKLEEDA 1410 green anole
XP_024840731 1335 TRQKLNVSTKLRQLEDERNSLQEQLDEEMEAKQNLERHISTLNI-----------------------QLSDSKKKLQDFA 1391 cattle
XP_025861267 1388 TRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLVLQS-----------------------QLADTKKKVDDDL 1444 red fox
CAG10783     1425 TRQKLNLSSQIRQLEVEKNTLVEQQEEDEEARRNLEKQLQMLQAqvesgppsrkipevlqwqtqaafQLSETKKKLDEDV 1504 spotted green...
Q6URW6       1406 AVLEAGEEARRRAAREAETLTQRLAEKTEAVERLERARRRLQQELDDATVDLGQQKQLLSTLEKKQRKFDQLLAEEKAAV 1485 house mouse
AAI62152     1383 GNVELLEEGKKRLQRDLEAANTQFEEKAAAYDKLEKTKNRLQQELEDTLMDLDNQRQLVSNLEKKQKKFDQMLAEEKSIS 1462 zebrafish
XP_023813027 1381 AAVELLEEGKKRLQRELEAASGDYEEKAAAYDKLEKSRGRLQQELEDVLMDLDSQRQLVSNLEKKQKKFDQMLAEERAVS 1460 Japanese medaka
TDH03366     1462 GTVEALEEGKKRLQRELEAANSDYEEKASAYDKLEKSRGRMQQELEDVLMDLDSQRQLVSNLEKKQKKFDQMLAEERAVS 1541 yellow perch
XP_005157988 1445 SAVEAGEETRRKMQRDLENAVQREKSKEEEKERIERQKERLREEIEDMTIALQRERQNCTALEKRQKKFDQCLAEEKAVS 1524 zebrafish
XP_004916275 1392 GMVEAMEEAKKKSYKELEFLQQRFDEKHQINDKLEKTRNRLQQELDDLMVDLDHQRQIVSNLEKKQKKFDQMLAEEKNIS 1471 tropical claw...
XP_016851550 1411 GVAEAIEEARRRAAKDLESLSVRYEERVQACDKLEKGRTRLQQELDDVTVALDQQRQVVSALEKKQKKFDQMLAEEKLIS 1490 green anole
XP_024840731 1392 STVELLEEGKKKFQKEIESLTQQYEEKAAAYDKLEKTKNRLQQELDDLVVDLDNQRQLVSNLEKKQKKFDQLLAEEKNIS 1471 cattle
XP_025861267 1445 GTIESLEEARKKLLKDVEALGQRLEEKALAYDKLEKTKNRLQQELDDLTVDLDHQRQIASNLEKKQKKFDQLLAEEKNIS 1524 red fox
CAG10783     1505 GVMEGLEELRRKLQKDVELTTQRLEEKTIAMDKMDKTKSRLQQELDDLVVDLDHQRQLVSNLEKKQKKFDQLLAEEKSIS 1584 spotted green...
Q6URW6       1486 LRAVEDRERIEAEGREREARALSLTRALEEEQEAREELERQNRALRAELEALLSSKDDVGKNVHELERARKAAEQAASDL 1565 house mouse
AAI62152     1463 SKYADERDRAEAEAREKETKALSLARALEEAQEAREEFERANKALRAEMEDLVSSKDDVGKNVHELEKSKRGLEAQVEEM 1542 zebrafish
XP_023813027 1461 AKSAEERDRAEAELREKETKVLALMKMLEDKQEALQEAERTVKALRVEMEDLISSKDDVGKSVHDLERAKRGLEAFVEEM 1540 Japanese medaka
TDH03366     1542 CKFAEERDRAEAEAREKETRVLALARALEENQGALEEAEKTMKGLRADMEDLISSKDDVGKSVHDLEKAKRGLEAIVDEM 1621 yellow perch
XP_005157988 1525 ARLQEERDRAEAESREKETRFLSLSRALQEATEQRDELERTNKQLRLEMEQLVNAQDDVGKNVHELERSRRALETEAQSL 1604 zebrafish
XP_004916275 1472 ARYGEERDRAEAEAREKETKALSLSRALEEAIDLKDELDRQNKQLRAEMDDLVSSKDDVGKNVHELERSKRALEQQVQEM 1551 tropical claw...
XP_016851550 1491 ARYAEERDRAEADAREKETKVLSLSRALEEALETREEMERQNKQLRAEMDDLVSSKDDVGKNVHELERFKRALEQQVQEM 1570 green anole
XP_024840731 1472 SKYADERDRAEAEAREKETKALSLARALEEALEAKEELERTNKMLKAEMEDLVSSKDDVGKNVHELEKSKRALETQMEEM 1551 cattle
XP_025861267 1525 ARYAEERDRAEAEAREKETKALSLARALEEALETKEEFERQNKQLRADMEDLISSKDDVGKNVHELEKSKRALEQQVEEM 1604 red fox
CAG10783     1585 ARYAEERDHAEAEAREKETKTLSMARALEEALDAKEELERLNKQLRAEMEDLMSSKDDVGKNVHELEKSKRTLEQQVEEM 1664 spotted green...
Q6URW6       1566 RTQVTELEDELTAAEDAKLRLEVTVQALKAQHERDLQGRDDAGEERRRQLAKQLRDAEVERDEERKQRALAMAARKKLEL 1645 house mouse
AAI62152     1543 KTQLEELEDELQAAEDAKLRLEVNMQALKAQFERDLQGRDEQGEEKKRQLVKQVRELETELEDERKQRTALAASKKKLEG 1622 zebrafish
XP_023813027 1541 KTQMEELEDELQVAEDAKLRLEVNSQALRAQHERELQAREEQGEEKRRQLLKQVRELEAELEEERKQRTLASAARKKLEG 1620 Japanese medaka
TDH03366     1622 RTQMEELEDELQVAEDAKLRLDVNTQALRAQHERELHARDELGEEKRKQLLKQVRELEAELEEERKQRGQASGSKKKLEG 1701 yellow perch
XP_005157988 1605 KEQTQELEDELGEAENARLRLEVTLQALRAQFEREISTKEEKGEEKRRALNKQVRELETMLEEEKTQRAQALTVKKQLET 1684 zebrafish
XP_004916275 1552 KTQIEELEDELQAIEDGKLRLEVNMQAMKAQFERDLQNRDDSNDEKKKLLFKQVREMEVELEEERKQKSQILVAKKKLEM 1631 tropical claw...
XP_016851550 1571 RAQMEELEDELQATEDGKLRLEVNMQALKAQHERELQNRDDANDDKKKLLSKQVRELEAELDAERKQRAQALAGRKKLEL 1650 green anole
XP_024840731 1552 KTQLEELEDELQATEDAKLRLEVNMQALKVQFERDLQARDEQNEEKRRQLQRQLHEYETELEDERKQRALAVAAKKKLEG 1631 cattle
XP_025861267 1605 RTQLEELEDELQATEDAKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLVKQVRELEAELEDERKQRALAVASKKKLEI 1684 red fox
CAG10783     1665 RTQLEELEDELQATEDAKLRLEVNMQAMKAQFERDLQAREEQGEEKKRALVKQVREMEAELEDERKQRALAVAGKKKLEL 1744 spotted green...
Q6URW6       1646 ELEELKAQTSAAGQGKEEAVKQLKKMQVQMKELWREVEETRSSRDEMFTLSRENEKKLKGLEAEVLRLQEELAASDRARR 1725 house mouse
AAI62152     1623 DLKDLEGQIETSNKGRDEAIKQLRKLQAQMKDFQRELDDAHAAREEVLSSAKENERKAKTLEAELLQLQEDLAAAERAKK 1702 zebrafish
XP_023813027 1621 EVKNTEEQLEAASRGRDEALKQLRKNQGQLKELHRELEEGRAAHKEILASAREAERRCKNLEAEILQMQEMLAAAERARK 1700 Japanese medaka
TDH03366     1702 ELKDMEDQLEATSRGRDEAVKQLRKIQGQVKDLQRDLEDSRAAQKEVLASARESERRSKAMEADIVQLHEMLAAVERARK 1781 yellow perch
XP_005157988 1685 ELQEAEAQVEAANRGREEAFRQMKRLQTQMKELIRELDETKLARDEIVAQSKDSEKRLQTLEAELLQLTEDLSVSERQKR 1764 zebrafish
XP_004916275 1632 DLQDMESQMDSANKGRDEAVKQLKKLQLQFKEVWREVEETRAARDEIFVQSRDNEKKLKSLEAELLQLQEDLAAAERAKR 1711 tropical claw...
XP_016851550 1651 DLQEAMAQLDAANKGRDEAGKQLRKLQAQMKELWREVEEARAAREEIFIQSRESEKKLKNLEAELLQLQEDLAASERAKR 1730 green anole
XP_024840731 1632 DLKDLELQADSAIKGREEAIKQLRKLQAQMKDFQRELEDARASRDEIFATAKENEKKAKSLEADLMQLQEDLAAAERARK 1711 cattle
XP_025861267 1685 DLKDLEAQIEAANKARDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARR 1764 red fox
CAG10783     1745 DLNELEGQAEAANKGRDEAVKQLRKLQAQVKDYQRELDEARASRDEIFTQAKDNEKKLKSLEAEVLQLQEEQAAAERARR 1824 spotted green...
Q6URW6       1726 QAQQDRDEMAEEVASGNLSKAATLEEKRQLEGRLSQLEEELEEEQNNSELLKDHYRKLVLQ----------VESLTTE-- 1793 house mouse
AAI62152     1703 QVEAERDELADELASNASGKSALSDEKRRLEAKIQQLEEELEEEQGNMEMLNDRLRKSAQQ----------VDQLTNE-- 1770 zebrafish
XP_023813027 1701 QAETERDELSEEVAGGSSGRSLLSDEKRRLEAKISQLEEELEEEQANVETLNERLRKSQQL----------VDQLGAE-- 1768 Japanese medaka
TDH03366     1782 QAEVERDELSEELASNsSGKSLMSDEKRRLDTKISQLEEELEEEQANVESLNDRLRKSQQL----------VEQLGAE-- 1849 yellow perch
XP_005157988 1765 QAQQERDEMADEIINNATGKSALFDEKRRLETRITQMEEELEEAQSNAELLAERQRKSTLQ----------IETLTVQ-- 1832 zebrafish
XP_004916275 1712 QAQQERDDLADELSNGVSGKSALLDEKRALEMRISQLEEELDEEQSNTELINDRYRKLTLQ----------VETITTE-- 1779 tropical claw...
XP_016851550 1731 QAQQERDDLADELANGNSGKSALLDEKRHLEARIGQLEEELDEEQSNMELLNDRYRKLSMQ----------VETLTTE-- 1798 green anole
XP_024840731 1712 QADLEKDELAEELASSVSGRNALQDEKRRLEARIAQLEEELEEEQGNTEAMSERVRKATQQ----------AEQLSNE-- 1779 cattle
XP_025861267 1765 HAEQERDELADEIANSASGKSALLDEKRRLEARIAQLEEELEEEQSNMELLNDRFRKTTLQ----------VDTLNAE-- 1832 red fox
CAG10783     1825 HAEQERDELAEEISSSTSGKSSLLEEKRRLEARLAQLEEELEEEQGNAELLNDRLRKATLQgllpvspapsVPGGRPEqr 1904 spotted green...
Q6URW6       1794 --LSAERS---------FSAKAESGRQQLERQIQELRARLGEEDAGARARQKMLIAALESK----------LAQAEEQLE 1852 house mouse
AAI62152     1771 --LQAERT---------TSQKNESARQLMERQNKELKAKLQEMENQVKSKFKSSISALEAK----------VAQLEEQLE 1829 zebrafish
XP_023813027 1769 --LTAERA---------SSQNREGSRLQLEKQTRDLKAKLQDVESQARSKLKSSVAALEAK----------LREAEEQLE 1827 Japanese medaka
TDH03366     1850 --LAAERS---------TSQSREGSRQQLERQNRELKAKMQEMEGQGRSKLKASIAALEAK----------LREAEEQLE 1908 yellow perch
XP_005157988 1833 --LSGERT---------LAQKSESARETLERQNKELKTRLSEMEGAVKGKHRLSVAALEAK----------IESMEEQVE 1891 zebrafish
XP_004916275 1780 --LSAERS---------FSQKAENARQQMERQNKELKVKLNEMDSTMRSKYKITIASLEAK----------ISQLEEQME 1838 tropical claw...
XP_016851550 1799 --LGAERS---------FSQKTENARQQLERQNKDLRAKLGEMDSSVKSKYKMAIATLESK----------VAQLEEQLE 1857 green anole
XP_024840731 1780 --LATERS---------AAQKNENARQQLERQNKELRSKLQEMEGAVKSKFKSTIAALEAK----------IAQLEEQVE 1838 cattle
XP_025861267 1833 --LAAERS---------AAQKSDNARQQLERQNKELKAKLQELEGAVKSKFKATISALEAK----------IGQLEEQLE 1891 red fox
CAG10783     1905 vgCGAQRWpeerersaaAGAPQQGAEGQAGGAGGDGQVQVQGLHQRAGGQAPAAGGAAGAGskresrgqqdAPPLREEAE 1984 spotted green...
Q6URW6       1853 QES---RERILSGKLVRRAEKRLKEVVLQVDEERRVADQVRDQLEKSNLRLKQLKRQLEEAEEEASRAQAGRRRLQRELE 1929 house mouse
AAI62152     1830 QES---RDKQNTAKAVRQKDKKLKEMMTQVEDERKQAEQYKDQADKATARVKQLKRQLEESEEESQRITAARRKLQRELD 1906 zebrafish
XP_023813027 1828 VES---RERQASAKNLRQKEKKLKDLTAQMEDERKQAQDYKDQMEKSSARMKQLKHQLEEAEEEAQRVAAARRKLQRELD 1904 Japanese medaka
TDH03366     1909 IES---RERQANGKNLRQKEKKLKDLTIQMEDERKQAQQYKDQAEKGNVRVKQLKHQLEEAEEEAQRMAAARRKLQRELD 1985 yellow perch
XP_005157988 1892 QER---QERAMANKLVRKTEKKLKEVLMQVEDERRHADQYREQLDKSMGRLRQLKRQLEEVEEENSRSNAQRRKLQRELE 1968 zebrafish
XP_004916275 1839 QES---KERIIANKLVRRAEKRLKEVLLQVEEERRNADQFKEQLEKANIRMKQLKRQLEEAEEEASRANSNRRRLQRELE 1915 tropical claw...
XP_016851550 1858 QES---RERILSGKLVRRAEKKLKEVILQVDEERRNADQYKDQVEKGHLRLKQLKRQLEEAEEEASRANASRRRMQRELE 1934 green anole
XP_024840731 1839 QEA---REKQATAKALKQKDKKLKEALLQVEDERKMAEQYKEQAEKGNLRVKQLKRQLEEAEEESQRINANRRKLQRELD 1915 cattle
XP_025861267 1892 QEA---KERAAANKLVRRTEKKLKEIFMQVEDERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQRELD 1968 red fox
CAG10783     1985 GGAaagGGRASARRPVQGAGRTAPPPLLRSISE----PPSPPQMEKANSRLKQLKRQLEEAEEEATRANASRRKLQRELD 2060 spotted green...
Q6URW6       1930 DVTESAESMNREVTTLRNRL 1949 house mouse
AAI62152     1907 EATETNDAMSREVNSLKSKL 1926 zebrafish
XP_023813027 1905 EALEANDALSREVSSLRSKL 1924 Japanese medaka
TDH03366     1986 EATEANDTLSRDMASLRSKL 2005 yellow perch
XP_005157988 1969 EMSDSMQSMNRELNTLRSQL 1988 zebrafish
XP_004916275 1916 DVTESAESMNREVTTLRSRL 1935 tropical clawed frog
XP_016851550 1935 DVTESAESMNREVTSLRNRL 1954 green anole
XP_024840731 1916 EATESNEAMGREVTALKSKL 1935 cattle
XP_025861267 1969 DATEANEGLSREVSTLKNRL 1988 red fox
CAG10783     2061 EAGEASEALSRELTSLKNRL 2080 spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap