Conserved Protein Domain Family
Myosin_tail_1

?
pfam01576: Myosin_tail_1 
Myosin tail
The myosin molecule is a multi-subunit complex made up of two heavy chains and four light chains it is a fundamental contractile protein found in all eukaryote cell types. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament. The coiled-coil region provides the structural backbone the thick filament.
Statistics
?
PSSM-Id: 307627
View PSSM: pfam01576
Aligned: 13 rows
Threshold Bit Score: 1280.5
Threshold Setting Gi: 528503547
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6URW6        869 TRQDEVLQARAQELQKVQELQQQSAREVGELQGRVAQLEEERTRLAEQLRAEAELCSEAEETRARLAARKQELELVVTEL 948  house mouse
XP_011476020  845 TRQEEEMVAKEEELLKVKEQQQEAEKRVKEYELKQQQLTEEKLALQEQLRAETMLCTEAEEMRARLAARKQELEEILNDL 924  Japanese medaka
AAI62152      846 TRQEEEMSLKEEELQKAKESAQKFEIELKDIALKHTQLMDERNQLQEKLQAETELYAEAEEMRVRLASKKQELEEILHEM 925  zebrafish
XP_009860140  849 TRQEEDLNAKERELKLVQEKKDELESSLHDIEKKFAQVCEEKNMLAEQLQTEQEVWNESEEMRARLAARKTELEEILQDM 928  vase tunicate
XP_005157988  908 TRQDEEIQAREAQLQKAKDKLSKLELDFTELDKKNQQLIEEKSVLTDQLQAEAELFAEAEEMRARLANRKQELEDVLGEL 987  zebrafish
XP_012822869  865 TRQDEVMQAKVVELQKVKDTQVKTESELKEMANKYQQLFEEKSILAEQLQAETELFAEAEEMRARLASKKQELEEILHDL 944  western clawe...
XP_016851550  874 TRQDEVMQAKAVELQKVQEKHTKTQMDLKELENKYQQLSEEKTILAEQLQAETELFAEAEEMRARLAARKQELEDILHEL 953  green anole
NP_001095597  848 TRQEEEMQAKEDELQKTKERQQKAESELKELEQKHSQLTEEKNLLQEQLQAETELYAEAEEMRVRLAAKKQELEEILHEM 927  cattle
XP_005620096  909 TRQEEELQAKDEELLKVKERQTKVEGELEEMERKHQQLLEEKNILTEQLQAETELFAEAEEMRARLAAKKQELEEILHDL 988  dog
XP_010753388  843 SRQEEEMLAKDEELNKVKEKHMYAEQQLHDLEEKQQQLNAEKMALQEQLQAETELCAEAEEMRARLAARKQELEEILHDL 922  large yellow ...
NP_001091647  845 TRQEEEMVAKEEELVKMKERQQQAEDQLKESEAKQKQLNAEKLALQEQLQAETELCQEAEEMRSRLTARMQEMEEVLHEL 924  zebrafish
CAG06107      924 TRQEEEMLAKEDELSKVKERQEQAEKMLKEYESKQQQLAAEKMALQEQLQAETELCAEAEELRARLVNRKQELEEILHDM 1003 spotted green...
XP_011610798  838 TRQEEEMLAKEDELSKVKEKQLQAEEMIKEFESKQQQLNAEKMALQEQLQAETELCAEAEEMRARLVNRKQELEEILHDM 917  torafugu
Q6URW6        949 EARVGEEEECSRQLQSEKKRLQQHIQELESHLEAEEGARQKLQLEKVTTEAKMKKFEEDLLLLEDQNSKLSKERRLLEER 1028 house mouse
XP_011476020  925 ESRLEEEEERASHMQVEKKKMQQNIIDLEQQLDEEEAARQKLQMEKVTTDAKLKKLEEDIMVLEDQNGKLNKEKKLLEER 1004 Japanese medaka
AAI62152      926 EARLEEEEDRGAALQMEKKKMHEQIKDLEEHLEEEEDARQKLQLEKVTCDAKIKKLEDDILIMDDQNNKLQKERKILEER 1005 zebrafish
XP_009860140  929 EARLDEEEDRNQGMMQEKKKMQTNIKDLEEQLDEEEAARQKLQLEKVTLDAKCKKMDEDLNLLEDAQSKLQRERKALEER 1008 vase tunicate
XP_005157988  988 ESRLEEEEERTVQLTNEKKRIQQHVQDLEEQLEEEEGTRQRLQLEKVTLESKVKSLEAETLTLAEQRDRLSKEKKQLEER 1067 zebrafish
XP_012822869  945 EARVEEEEERTLQLQNEKKKMHQHIQDLEEQLEEEEGARQKLQLEKVTTESRLKKMEEDILLLEDQNAKLAKERKLLDDR 1024 western clawe...
XP_016851550  954 ESRVEEEEERCQQLQGDKKKMQQHVQDLEEQLEEEEAARQKLQLEKVSTEAKLKKMEEDLLVLEDQNSKLHKERKLMEER 1033 green anole
NP_001095597  928 EARLEEEEDRSQQLQAERKKMAQQMLDLEEQLEEEEAARQKLQLEKVTAEAKIKKLEDDILVMDDQNNKLSkERKLLEER 1007 cattle
XP_005620096  989 ESRVEEEEERNQILQNEKKKMQAHIQDLEEQLDEEEGARQKLQLEKVTAEAKIKKMEEEILLLEDQNSKFIKEKKLMEDR 1068 dog
XP_010753388  923 EARVEEEEERASQLLGEKKKMQQNIGDLEQQLDEEEAARQKLQLEKVTMEAKMKKIEEDVMVLDDQNNKLNKEKKLMEER 1002 large yellow ...
NP_001091647  925 ESRLEEEEERVAQFQSEKKKMQQNIGDLEQQLDEEEAARQKLQLEKVTMDAKLKKIEEDLMVIEDQNAKLSKEKKQMEER 1004 zebrafish
CAG06107     1004 ESRLEEEEERANQLHIERKKMQQNIADLEQQLDEEEAARQKLQIEKVTTDSKIKEHEERILMLEDQNNKLNKTAS----- 1078 spotted green...
XP_011610798  918 ESRLEEEEERVNQMLNERKKMQQNIADLEQQLDEEEADRQKLQMEKVTTDSKMKALEGNIMVLDDQNNKLNKEKKLLEDR 997  torafugu
Q6URW6       1029 LAEFSSQAAEEEEKVKSLNKLRLKYEATISDMEDRLKKEEKGRQELEKLKRRLDGESSELQEQMVEQKQRAEELLAQLGR 1108 house mouse
XP_011476020 1005 ISEFTTNMAEEEEKSKSLQKLKNKHEAMITELEDRLRKEEKMRQELEKNRRKLEGDSSELHDQMLDLQAQIDELRAQLAK 1084 Japanese medaka
AAI62152     1006 IADFSSNLAEEEEKSKNLTKLKNKHESMISELEVRLKKEEKTRQELDKAKRKLEAESNDLQEQIADLQAQIADLKAQLAK 1085 zebrafish
XP_009860140 1009 VNELEGTLGDEEEKAKMLSKLKHKNESVISDLQERLKKEEKLRQELEKIKRQLEAEIAELREQIADLQLQLEELRVQNQR 1088 vase tunicate
XP_005157988 1068 LNEVTDQLTEEEEKVKSLNKLKNKQEAVIADIEERLKREEQGRLEQEKWKRRMEGEAVEAQEQLSDMSLLVTELRGSLSQ 1147 zebrafish
XP_012822869 1025 IGEFTSTMAEEEEKVKSLNKLRNKYEAVIADLEDRLKKEEKGRQEMEKMKRKLDGETTDLQDQLLELQQQIEELKQQLAR 1104 western clawe...
XP_016851550 1034 LSEFTSHMAEEEEKVKSLSKLRNKYEAVMADMEDRLKKEEKGRQELEKLKRKLDGEAGDLQEQVAELQQQLEELRQALAR 1113 green anole
NP_001095597 1008 ISDLTTNLAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKLKRKLDGEASDLHEQIAELQAQIAELKMQLAK 1087 cattle
XP_005620096 1069 IAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKVQLAK 1148 dog
XP_010753388 1003 ISEFTTNLAEEEEKSKSLQKLKTKHEAMITDLEDRLRREEKQRQELEKNRRKLEGDFTEIHDQIAELQAQIAELRAQLAK 1082 large yellow ...
NP_001091647 1005 ISEFTTNLAEEEEKSKSLQKLKTKHETMITDLEDRLRKEEKMRQELEKNRRKLEGDSTELHDQIAELQAQIAELRAQLAK 1084 zebrafish
CAG06107     1079 ---------------------------------GKRRKCAKSWRRTVANWRASPRTSTT-RSQTCRPRSQIC-AA-QLAK 1122 spotted green...
XP_011610798  998 IAEFSSNLSEEEEKSRSLQKLKNKHEAIITDLEDRLRKEEKQRQELEKNRRKLEGDSTDLHDQIADLQAQIADLRAQLAN 1077 torafugu
Q6URW6       1109 KEDELQAALLRAEEEGGARAQLLKSLREAQAGLAEAQEDLEAERVARAKAEKQRRDLGEELEALRGELEDTLDSTNAQQE 1188 house mouse
XP_011476020 1085 KEEELLAALAKIEEEAAAKNTAQKKVRELEAQISELLEDLELEKQARSKTEKQRRDLGEELEALKAELENSLDSTALQKE 1164 Japanese medaka
AAI62152     1086 KEEELQAALARLEDETGQKNNALKKIRELEGHISDLQEDLESERAARNKAEKTKRDLGEELEALKSELEDTLDTTATQQE 1165 zebrafish
XP_009860140 1089 KDDELAALQDKFDQEQTARSQLAKNHRELQNQNAEVLEDLEQERSQRNKAEKQKRDLSEELEALKTELEDSLDTTNAQQE 1168 vase tunicate
XP_005157988 1148 REKEITTLQTRLEEEGARRTEAQRALREAMSQVSELKEEVENERGMRERAEKQRRDLGEELEALRTELEDTLDTTAAQQE 1227 zebrafish
XP_012822869 1105 KEEELQAALARVDDEVGQKNNLLKQLRDLQSQLAELHEDLESEKAARAKAEKQRRDLGEELEALKTELEDTLDSTAAQQE 1184 western clawe...
XP_016851550 1114 KEAELQAALARVEDEAAQKNAVLKSLRELQAQLAELQEDMESEKLARAKAEKQRRDLGEELEALKTELEDTLDSTAAQQE 1193 green anole
NP_001095597 1088 KEEELQAALGRLDDEMAQKNNALKKIRELEGHISDLQEDLDSERAARNKAEKQKRDLGEELEALKTELEDTLDSTATQQE 1167 cattle
XP_005620096 1149 KEEELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEALKTELEDTLDTTAAQQE 1228 dog
XP_010753388 1083 KEEELQAALARIEEEAAQKNLAQKKIREMEAQLSELQEDLELERQARTKAEKHRRDLGEELEALKTELEDTLDSTAAQQE 1162 large yellow ...
NP_001091647 1085 KEEELQAALARIEEEAALKNAAQKSIREMEAQISELQEDLELEKAARNKAEKQRRDLGEELEALKTELEDTLDSTAAQQE 1164 zebrafish
CAG06107     1123 KEEELQDALNRLDKSSADNTAAQKKNRELEAHILELEEDLARECGYRAQSTQRCKDLEEELEALKTELLDTLDSTAVQQE 1202 spotted green...
XP_011610798 1078 KEEELQNALIRIEEEAAANMASQKKIKELEAQILELDEDLEREKFYRSKNGQRCKELEKELEAIKNKLDDTLDTTAAQQE 1157 torafugu
Q6URW6       1189 LRSKREQEVTELKKALEEESRAHEVSMQELRQRHSQALVEMAEQLEQARRGKGVWEKTRLSLEAEVSELKAELSSLQTSR 1268 house mouse
XP_011476020 1165 LKDKRESEVAQLKKTLEDEAQSHEQQLADMRHKHNQAFEELNEQLEQAKRSKVSVEKTKQALESELNELQIEMQSLTQAK 1244 Japanese medaka
AAI62152     1166 LRAKREQEVTLLKRAIEDESRVHEAQVQEMRQKHTQALEELTEQLEQSKRVKVNLEKAKQALEKETSELHVELRSLTQGK 1245 zebrafish
XP_009860140 1169 LKSQRERELENLKRTLESETTSFDTQLQQMRQKHNSQVETFQDELDVLKRNKSALEKSKHSLESENQELQEELRLVSGAK 1248 vase tunicate
XP_005157988 1228 LRSRREAELGELQRCLEEETRRHEAQLSELRIKHTAAIDSLQEQLDNAKRSRQSLEKAKAVLEEERLNLSAELKTLQGGK 1307 zebrafish
XP_012822869 1185 LRAKREQEVTDLKKTIEEDVKVRDAQVTEMRQRHNQVVEEISEQLEQARRFKGNLEKVKQTLESENTDLIKEVKNLQAAK 1264 western clawe...
XP_016851550 1194 LRSKREQEVTELKKTIEEEVKVHEAQVLDMRQRHTSALEELSEQLEQSRRFKINLEKTKQALEGENAEMQKEVKLLQAAK 1273 green anole
NP_001095597 1168 LRAKREQEVTMLKKALDEETRSHESQVQEMRQKHTQVVEELTEQLEQFKRAKANLDKNKQALEKENAELAGELRVLSQAK 1247 cattle
XP_005620096 1229 LRTKREQEVAELKKALEEETRSHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVK 1308 dog
XP_010753388 1163 LRTKRETEVAQLKKTLDEEARVHEQQLGEMRQKHGQAFDELNEQLEQAKRNKVSMEKAKQALESERNELAIEIQTLMQGK 1242 large yellow ...
NP_001091647 1165 LRAKRETEVTQLKKTLEDEARAHEQMLSEVRQKHNQAFEELNEQLEQSKRSKASVDKAKQALESERNELQIELKSLSQSK 1244 zebrafish
CAG06107     1203 LRTKRETEVAQLKKAGEEEKKMHEAQLAELSKKHFQTLNELNEQLEQTKRNKMSVEKAKQALESEFNELQTEMRTVNQRK 1282 spotted green...
XP_011610798 1158 LRAKRETEVAQLRKAQEEENKMHESQIAELSKKHLQAFNEMNEQLEQAKRNKLSVEKAKQALESEFNELQIELKTLGQSK 1237 torafugu
Q6URW6       1269 QEGEQKRRRLESQLQEVQGRSSDSERARSEAAEKLQRAQAELESVSTALSEAESKAIRLGKELSSAESQLHDTQELLQEE 1348 house mouse
XP_011476020 1245 GDSEHRRKKAEAQLQELQIKSTESERQRKELSEKLTKMQAELETVNSSLSKAEGNAIKSSKDLSSVQSQLQDTQELLQEE 1324 Japanese medaka
AAI62152     1246 QDVEHKKKKLEGQLADLQSRFNDSERHKAELGDRVSKITVELESVTNLLNEAEGKNIKLSKDVASLSSQVQDTQELLAEE 1325 zebrafish
XP_009860140 1249 TDSETKRRKQDQQLQELSAKLQDTERQRNDLQDKLSKGQLEIESLSHNLEQVETQLSRSQKEASQLDSQLQDAQSQGQEE 1328 vase tunicate
XP_005157988 1308 MESERGRKRAEGQLQELNARLSQAEREREEREERLGKLQSELESLSSSLSSSDSKSHRLHKEVSSLESQLHDVQELLQEE 1387 zebrafish
XP_012822869 1265 QDSEQRRKKLEQQVSEFQIRTNESEKVKFELAEKLQKLQAELDGVSGALGSTEGKSIKLTKDLSTVQSQLQDTQELLQEE 1344 western clawe...
XP_016851550 1274 LESEQRRKKLEGQVQELQLRAGEGERAKAELVERLVKLQNELDGVSGTLGSTESKTIKLAKDLATVESHLQDTQELLQEE 1353 green anole
NP_001095597 1248 QEVEHKKKKLEVQLQELQSKYSDGEKVRAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASLGSQLQDTQELLQEE 1327 cattle
XP_005620096 1309 AESEHKRKKLDAQVQELHAKVSEGDRLRVELAEKANKLQNELDNVSSLLEEAEKKGIKFAKDAASLESQLQDTQELLQEE 1388 dog
XP_010753388 1243 TDSEHRRKKAEGQVQELLLKHSESERQRVEQAEKLSKVQAELDNVNALLSDVEGKSIKAAKDCSAVESQLQDVQELLQEE 1322 large yellow ...
NP_001091647 1245 NDSENRRKKAESQLQELQVKHTESERQKHELLDKVSKMQAELESLQGTVTKVESKSIKAAKDCSAVESQLKDAQALLEEE 1324 zebrafish
CAG06107     1283 SDTEHRRKKAESQVQELQVRCDETERQKQEALEKVAKLQSELDNVNAIVNALEGKCTKSSKDLSSVESHLQDTQELLQEE 1362 spotted green...
XP_011610798 1238 SDSEHRRKKAESQVQELQVKYGDCERQRQEAVEKIAKLQSELENVNSLLNESEGKNTKSSKDMLSLESHLQDTQELLQEE 1317 torafugu
Q6URW6       1349 TRAKLALGSRVRALEAEAAGLREQMEEEVVARERAGRELQSTQAQLSEWRRRQEEEAAVLEAGEEARRRAAREAETLTQR 1428 house mouse
XP_011476020 1325 TRQKLALTSRLKQMEEQQNNLRETLEEEEEAKRNAEKLVASLQAQVADMKKKMENDTSVLEGAEEGRKKVQRELDSLLLQ 1404 Japanese medaka
AAI62152     1326 TRQKLQLSTKLRQIEDDRNALQEQLDEEAEAKRNVERHVSTLNIQLSDFKKKLEEMTGNVELLEEGKKRLQRDLEAANTQ 1405 zebrafish
XP_009860140 1329 TQAKLKYAHKIRSLEDERTSLEEQLEEEEESRKAVEKQLSTANIALQDLKKKMEGDAEAIDQLEESKKRYQRELEDKTQQ 1408 vase tunicate
XP_005157988 1388 TRQKLALGSRVRALEEEKAGLMERLEEEEEKTRELTRQIQNHTQQLADLKRQTEEVNSAVEAGEETRRKMQRDLENAVQR 1467 zebrafish
XP_012822869 1345 TRQKLNFSSRVRQLEEEKNNLMENLEEEESAKAQLSRQLQALQQQLLESKKRMEDQGGMVEAMEEAKKKSYKELEFLQQR 1424 western clawe...
XP_016851550 1354 TRQKLNLSSRVRQLEEEKAAMLEQLEEEEAAKANFSRQMQSLQQQVMETKKKLEEDAGVAEAIEEARRRAAKDLESLSVR 1433 green anole
NP_001095597 1328 TRQKLNVSTKLRQLEDERNSLQEQLDEEMEAKQNLERHISTLNIQLSDSKKKLQDFASTVELLEEGKKKFQKEIESLTQQ 1407 cattle
XP_005620096 1389 TRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLVLQSQLADTKKKVDDDLGTIESLEEARKKLLKDVEALGQR 1468 dog
XP_010753388 1323 TRQKLSHSTRLRQLEDEQNNLREQLEEEEESKRNVEKQLQMVQAQLTEMKKKVEQDAGCLETVEESKKRLQRDLEGTNQR 1402 large yellow ...
NP_001091647 1325 TRQKLAISTRLRQLEDEQNNLKEMLEEEEESKKNVEKQLHTAQAQLAEMKKKIEQEAQSLESMEDGKKKLQREVESVLQQ 1404 zebrafish
CAG06107     1363 TRQKLSLSTRLKQMEDEQTGLQEMLEEEEEAKRTVEKQISTLNAQLSEMKKKVEQEALSLEAAEEDRKRLKSESDALRLQ 1442 spotted green...
XP_011610798 1318 TRQKLAISTRFRQMEEEQNSLREMLEEEEEAKKNVEKQISVLQGQLGDMKKKMDQEVSSLESAEESRKRLQREFDTVKLQ 1397 torafugu
Q6URW6       1429 LAEKTEAVERLERARRRLQQELDDATVDLGQQKQLLSTLEKKQRKFDQLLAEEKAAVLRAVEDRERIEAEGREREARALS 1508 house mouse
XP_011476020 1405 LEEKTAAYDKLDKTKTRLQQELDDLLVDQDQLRQIVCNLEKKQKKFDQMLAEEKTNSTKCAEERDRAEAEAREKETRALN 1484 Japanese medaka
AAI62152     1406 FEEKAAAYDKLEKTKNRLQQELEDTLMDLDNQRQLVSNLEKKQKKFDQMLAEEKSISSKYADERDRAEAEAREKETKALS 1485 zebrafish
XP_009860140 1409 LEEKSAQADKLEKTNKRLQGDYDDLSVEVDHNRSVISSLEKKQRQFDKALADERMISAKNAEERDQAEREAREKDTKAIS 1488 vase tunicate
XP_005157988 1468 EKSKEEEKERIERQKERLREEIEDMTIALQRERQNCTALEKRQKKFDQCLAEEKAVSARLQEERDRAEAESREKETRFLS 1547 zebrafish
XP_012822869 1425 FDEKHQINDKLEKTRNRLQQELDDLMVDLDHQRQIVSNLEKKQKKFDQMLAEEKNISARYGEERDRAEAEAREKETKALS 1504 western clawe...
XP_016851550 1434 YEERVQACDKLEKGRTRLQQELDDVTVALDQQRQVVSALEKKQKKFDQMLAEEKLISARYAEERDRAEADAREKETKVLS 1513 green anole
NP_001095597 1408 YEEKAAAYDKLEKTKNRLQQELDDLVVDLDNQRQLVSNLEKKQKKFDQLLAEEKNISSKYADERDRAEAEAREKETKALS 1487 cattle
XP_005620096 1469 LEEKALAYDKLEKTKNRLQQELDDLTVDLDHQRQIASNLEKKQKKFDQLLAEEKNISARYAEERDRAEAEAREKETKALS 1548 dog
XP_010753388 1403 LEEKCAAYEKLDKTKTRLQQELDDMLVDQDHLRQIVSNLEKKQKKFDQMLAEEKNISARYAEERDRAEAEAREKETRALA 1482 large yellow ...
NP_001091647 1405 LEERNASYDKLDKTKTRLQRELDDVLVDQGHLRQTVQELERKQKKFDQMLAEEKSISTKYAEERDRAEAEAREKETKSLT 1484 zebrafish
CAG06107     1443 LEEKEAAYEKLEKTKTRLQQELDDLLVNQDSQRQLVNNMEKKQRKFDQMLAEEKAISNQRADERDRAEADAREKETRALT 1522 spotted green...
XP_011610798 1398 LEEKEAAYEKLERTKTRLQQELDDLLVNQDGLRQLVNNMERKQRKFDQMLAEEKTISTQYAEERDKAEAEAREKETRALT 1477 torafugu
Q6URW6       1509 LTRALEEEQEAREELERQNRALRAELEALLSSKDDVGKNVHELERARKAAEQAASDLRTQVTELEDELTAAEDAKLRLEV 1588 house mouse
XP_011476020 1485 LTRELETMTGLRDDLERANKLLKAEMEDLISSTTGVGKNVHELERAKRAMEQQLEEMKLQLEELEDELQLTEDAKLRLEV 1564 Japanese medaka
AAI62152     1486 LARALEEAQEAREEFERANKALRAEMEDLVSSKDDVGKNVHELEKSKRGLEAQVEEMKTQLEELEDELQAAEDAKLRLEV 1565 zebrafish
XP_009860140 1489 LSHECDELKDKIDELERVRRSQQAELDELVSSKDATGKSAHELERSKRLLESQMEEMKTQLEELEDELQVTEDAKLRLEV 1568 vase tunicate
XP_005157988 1548 LSRALQEATEQRDELERTNKQLRLEMEQLVNAQDDVGKNVHELERSRRALETEAQSLKEQTQELEDELGEAENARLRLEV 1627 zebrafish
XP_012822869 1505 LSRALEEAIDLKDELDRQNKQLRAEMDDLVSSKDDVGKNVHELERSKRALEQQVQEMKTQIEELEDELQAIEDGKLRLEV 1584 western clawe...
XP_016851550 1514 LSRALEEALETREEMERQNKQLRAEMDDLVSSKDDVGKNVHELERFKRALEQQVQEMRAQMEELEDELQATEDGKLRLEV 1593 green anole
NP_001095597 1488 LARALEEALEAKEELERTNKMLKAEMEDLVSSKDDVGKNVHELEKSKRALETQMEEMKTQLEELEDELQATEDAKLRLEV 1567 cattle
XP_005620096 1549 LARALEEALETKEEFERQNKQLRADMEDLISSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATEDAKLRLEV 1628 dog
XP_010753388 1483 LTRELDSLMDVKEELDRGNKLLRAEMEDLVSSKDDVGKNVHELEKAKRAMEQQLEEMKTQLEELEDELQATEDAKLRLEV 1562 large yellow ...
NP_001091647 1485 LARELEAMTDLKNELERVNKQLKTEMEDLVSSKDDAGKSVHELERAKRGMEQQLEEMKTQLEELEDELQLTEDAKLRLEV 1564 zebrafish
CAG06107     1523 LSRELEDLRDHKKDLEEANRLLKAEMEDLISSKDDAGKNVHELERSKRAMEQQLAEMKTQLEELEDELQATEDAKLRLEV 1602 spotted green...
XP_011610798 1478 LARELETITDLKNELERTNKQLKAEMEDLVSSKDDAGKNVHELERSKRATEQQLEEIKTQLEELEDELQATEDAKLRLEV 1557 torafugu
Q6URW6       1589 TVQALKAQHERDLQGRDDAGEERRRQLAKQLRDAEVERDEERKQRALAMAARKKLELELEELKAQTSAAGQGKEEAVKQL 1668 house mouse
XP_011476020 1565 NLQATKAQFDRDLQAKEEQGEERRKQLVKQVRDMEVELEEERRQRSQALTSKKKLELDLADLEAQIDLANKGRDDALKQL 1644 Japanese medaka
AAI62152     1566 NMQALKAQFERDLQGRDEQGEEKKRQLVKQVRELETELEDERKQRTALAASKKKLEGDLKDLEGQIETSNKGRDEAIKQL 1645 zebrafish
XP_009860140 1569 NLQAAKTNFERDLNAREEQAEEKRRSILKQLRELEAELEEERKQKSNAIAAKKKMEMDFSDLESHIDAASKGKEDAVKQL 1648 vase tunicate
XP_005157988 1628 TLQALRAQFEREISTKEEKGEEKRRALNKQVRELETMLEEEKTQRAQALTVKKQLETELQEAEAQVEAANRGREEAFRQM 1707 zebrafish
XP_012822869 1585 NMQAMKAQFERDLQNRDDSNDEKKKLLFKQVREMEVELEEERKQKSQILVAKKKLEMDLQDMESQMDSANKGRDEAVKQL 1664 western clawe...
XP_016851550 1594 NMQALKAQHERELQNRDDANDDKKKLLSKQVRELEAELDAERKQRAQALAGRKKLELDLQEAMAQLDAANKGRDEAGKQL 1673 green anole
NP_001095597 1568 NMQALKVQFERDLQARDEQNEEKRRQLQRQLHEYETELEDERKQRALAVAAKKKLEGDLKDLELQADSAIKGREEAIKQL 1647 cattle
XP_005620096 1629 NMQAMKAQFERDLQTRDEQNEEKKRLLVKQVRELEAELEDERKQRALAVASKKKLEIDLKDLEAQIEAANKARDEVIKQL 1708 dog
XP_010753388 1563 NMQAMKAQYERDLAGRDEMGEEKKRSLVKQVREMEMELEDERKQRSAAVAARKKMELDLKELEAGIDMANKNRDEALKQL 1642 large yellow ...
NP_001091647 1565 NMQALKAQFERDLQSRDEQGEEKRKQLVKQVREMEMELEDERKQRAQAVSVRKKLELDLSELAAQIDLANKARDEALKQL 1644 zebrafish
CAG06107     1603 NMQAMKAQFDRDLQARDEQGEERRKQLVKQVHEFEAELEDERRQRSQAVSAKKKLELDLGELEAHINDANKGREEALKQL 1682 spotted green...
XP_011610798 1558 NMQAMKAQFDRDLQARDEQGEERRKQLVKQVHELEAELEDERRQRSQAVSAKKKLELDLGELEVHIDAANKGRDEALKQL 1637 torafugu
Q6URW6       1669 KKMQVQMKELWREVEETRSSRDEMFTLSRENEKKLKGLEAEVLRLQEELAASDRARRQAQQDRDEMAEEVASGNLSKAAT 1748 house mouse
XP_011476020 1645 KKLQAQMKDQTRELEDLRLSKDEAVNSAKETEKKLKASEANSLHLQEDLATSDRMKKQLQRERDELQDEVNSGITKNSLL 1724 Japanese medaka
AAI62152     1646 RKLQAQMKDFQRELDDAHAAREEVLSSAKENERKAKTLEAELLQLQEDLAAAERAKKQVEAERDELADELASNASGKSAL 1725 zebrafish
XP_009860140 1649 KKAQAQLKEYQRDLDEVRQSRDDLLITSRESDKKAKNLEADLMQAQEDLSASERHRRTVEAERDELQEEIAGGLKDKNAQ 1728 vase tunicate
XP_005157988 1708 KRLQTQMKELIRELDETKLARDEIVAQSKDSEKRLQTLEAELLQLTEDLSVSERQKRQAQQERDEMADEIINNATGKSAL 1787 zebrafish
XP_012822869 1665 KKLQLQFKEVWREVEETRAARDEIFVQSRDNEKKLKSLEAELLQLQEDLAAAERAKRQAQQERDDLADELSNGVSGKSAL 1744 western clawe...
XP_016851550 1674 RKLQAQMKELWREVEEARAAREEIFIQSRESEKKLKNLEAELLQLQEDLAASERAKRQAQQERDDLADELANGNSGKSAL 1753 green anole
NP_001095597 1648 RKLQAQMKDFQRELEDARASRDEIFATAKENEKKAKSLEADLMQLQEDLAAAERARKQADLEKDELAEELASSVSGRNAL 1727 cattle
XP_005620096 1709 RKLQAQMKDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARRHAEQERDELADEIANSASGKSAL 1788 dog
XP_010753388 1643 KKLQAQMKDLIRELDDTRMSREEILAQSKETEKKLKGMEADMLQMQEELAAAERVKRQAQQERDELQDEINNQASKNAQV 1722 large yellow ...
NP_001091647 1645 KKLQAQMKEQMREFEDLRLSRDESLNQAKENERKIKSMEAEIMQLHEDLAAADRAKRQIQQERDELQDEINSQNAKNSLS 1724 zebrafish
CAG06107     1683 KKLQAQFKDLARECDELRLSRDEALNCSKETERKLKSMEAETLQFQEDLASADRLKRQIQTERDELQDEVKDGNAKNSIL 1762 spotted green...
XP_011610798 1638 KKLQVQFKDMMRESEDLRLSRDEAINSAKETEKKVKTMEADAAQFQEDLATAERLKRQMQAERDELQDEINGNNTKNSML 1717 torafugu
Q6URW6       1749 LEEKRQLEGRLSQLEEELEEEQNNSELLKDHYRKLVLQVESLTTELSAERSFSAKAESGRQQLERQIQELRARLGEEDAG 1828 house mouse
XP_011476020 1725 TEEKRRLEARITQLEEELEEEHLDKEMTNDRLRRATQQSDQLTTELATERSNSQKLEGSRSQLDRQNKELKLKLQEMEGA 1804 Japanese medaka
AAI62152     1726 SDEKRRLEAKIQQLEEELEEEQGNMEMLNDRLRKSAQQVDQLTNELQAERTTSQKNESARQLMERQNKELKAKLQEMENQ 1805 zebrafish
XP_009860140 1729 QDDKRRIEARIADMEEENEDLASTVEILDEKNRKLQSQNEQLQNELSSERSSLQKQESAKSHLERQNKELKLKLSEMEQT 1808 vase tunicate
XP_005157988 1788 FDEKRRLETRITQMEEELEEAQSNAELLAERQRKSTLQIETLTVQLSGERTLAQKSESARETLERQNKELKTRLSEMEGA 1867 zebrafish
XP_012822869 1745 LDEKRALEMRISQLEEELDEEQSNTELINDRYRKLTLQVETITTELSAERSFSQKAENARQQMERQNKELKVKLNEMDST 1824 western clawe...
XP_016851550 1754 LDEKRHLEARIGQLEEELDEEQSNMELLNDRYRKLSMQVETLTTELGAERSFSQKTENARQQLERQNKDLRAKLGEMDSS 1833 green anole
NP_001095597 1728 QDEKRRLEARIAQLEEELEEEQGNTEAMSERVRKATQQAEQLSNELATERSAAQKNENARQQLERQNKELRSKLQEMEGA 1807 cattle
XP_005620096 1789 LDEKRRLEARIAQLEEELEEEQSNMELLNDRFRKTTLQVDTLNAELAAERSAAQKSDNARQQLERQNKELKAKLQELEGA 1868 dog
XP_010753388 1723 VEERRRLEARIAQLEEELEEEQCNTELINDRLKKAMLQTDQMNVELTAERSSSQRVEGARAQLERQNKELKLKLQELEGT 1802 large yellow ...
NP_001091647 1725 SDERRRLEARIAQLEEELEEEHLSVELVNDRLKKASLQAEQVTVELTAERSNSQRLEGLRSQLDRQNKDMKQKLQELEGA 1804 zebrafish
CAG06107     1763 QEDKRRLDDQIAQLKEELEEEQLNTEMSNERYKRAAQQCDQLNAELTSERSHSQQLEGARSQAERKNKELSLKLQELEST 1842 spotted green...
XP_011610798 1718 QDEKRRLEARITQLEEELEEEQLNSEMANDRNKRTTLQVDQLTAELSAERSAAQRLEGARSQAERKNKELSLKLQELEST 1797 torafugu
Q6URW6       1829 ARARQKMLIAALESKLAQAEEQLEQESRERILSGKLVRRAEKRLKEVVLQVDEERRVADQVRDQLEKSNLRLKQLKRQLE 1908 house mouse
XP_011476020 1805 IKSKYKSTISTMEAKIAQLEEQLDKEAKDHQQAAKLTRKTEKKLREVMLQAEDERRQSEISKDEVNKANSKINQLKRQLE 1884 Japanese medaka
AAI62152     1806 VKSKFKSSISALEAKVAQLEEQLEQESRDKQNTAKAVRQKDKKLKEMMTQVEDERKQAEQYKDQADKATARVKQLKRQLE 1885 zebrafish
XP_009860140 1809 VRTKQKNAIAALEAKILSTEEQLEAEAKERSAANKLLRRSEKKLKETLLLVDDERNHADQYKEQVDKVSSRVKALKRQLD 1888 vase tunicate
XP_005157988 1868 VKGKHRLSVAALEAKIESMEEQVEQERQERAMANKLVRKTEKKLKEVLMQVEDERRHADQYREQLDKSMGRLRQLKRQLE 1947 zebrafish
XP_012822869 1825 MRSKYKITIASLEAKISQLEEQMEQESKERIIANKLVRRAEKRLKEVLLQVEEERRNADQFKEQLEKANIRMKQLKRQLE 1904 western clawe...
XP_016851550 1834 VKSKYKMAIATLESKVAQLEEQLEQESRERILSGKLVRRAEKKLKEVILQVDEERRNADQYKDQVEKGHLRLKQLKRQLE 1913 green anole
NP_001095597 1808 VKSKFKSTIAALEAKIAQLEEQVEQEAREKQATAKALKQKDKKLKEALLQVEDERKMAEQYKEQAEKGNLRVKQLKRQLE 1887 cattle
XP_005620096 1869 VKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVEDERRHADQYKEQMEKANARMKQLKRQLE 1948 dog
XP_010753388 1803 VKSKYKANMSALEAKIAQLEEQLDMETRERQAATKLVRRTEKKLKEVILQVDDERRNTEQHKDQVDKLNSRMKQLKRQLE 1882 large yellow ...
NP_001091647 1805 VKSKYKSTITALETKIQQLEEQLDSEMKERQQSTKQVRRVEKKLKEVLLQVEDERRNADQSKTETEKANIRLKQMKRQLE 1884 zebrafish
CAG06107     1843 IKSKYKSSISSLEAKVAQLEEQLDAEIRERQQASRTVRRSEKKLKELLIQVEDERRNSEQYKDQADKLNSRMRQLKRQLE 1922 spotted green...
XP_011610798 1798 IKSKYKSSLTALEAKVAQLEEQLDTEIKERQQATRMVRRTEKKMKELVLQVEDERRNTEQYKDQADKLNSRTRQLKRQLE 1877 torafugu
Q6URW6       1909 EAEEEASRAQAGRRRLQRELEDVTESAESMNREVTTLRNRL 1949 house mouse
XP_011476020 1885 ETEEDLSRANAKARKLQRELDDANESADAMNREVSSLRSKL 1925 Japanese medaka
AAI62152     1886 ESEEESQRITAARRKLQRELDEATETNDAMSREVNSLKSKL 1926 zebrafish
XP_009860140 1889 DAEEEVSRANAAKRKIQRDLDDTTEQNETLHREVSQLRNKL 1929 vase tunicate
XP_005157988 1948 EVEEENSRSNAQRRKLQRELEEMSDSMQSMNRELNTLRSQL 1988 zebrafish
XP_012822869 1905 EAEEEASRANSNRRRLQRELEDVTESAESMNREVTTLRSRL 1945 western clawed frog
XP_016851550 1914 EAEEEASRANASRRRMQRELEDVTESAESMNREVTSLRNRL 1954 green anole
NP_001095597 1888 EAEEESQRINANRRKLQRELDEATESNEAMGREVTALKSKL 1928 cattle
XP_005620096 1949 EAEEEATRANASRRKLQRELDDATEANEGLSREVSTLKNRL 1989 dog
XP_010753388 1883 EAEEEAQRANANRRKLQRELEDATESADAMNREVTTLKNKL 1923 large yellow croaker
NP_001091647 1885 ETEEEAARANASCRKLRRELEDATESASAMNREVSTLKNKL 1925 zebrafish
CAG06107     1923 EAEEEVTRANAYRRKLQRELDDASETADAMNREVSTLKSKL 1963 spotted green pufferfish
XP_011610798 1878 EAEEEVTRANAYRRKLQRELEDANETQDTMNREVNILKSKl 1918 torafugu
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap