Conserved Protein Domain Family
PPR

?
pfam01535: PPR 
PPR repeat
This repeat has no known function. It is about 35 amino acids long and found in up to 18 copies in some proteins. This family appears to be greatly expanded in plants. This repeat occurs in PET309 that may be involved in RNA stabilisation. This domain occurs in crp1 that is involved in RNA processing. This repeat is associated with a predicted plant protein that has a domain organisation similar to the human BRCA1 protein. The repeat has been called PPR.
Statistics
?
PSSM-Id: 307604
View PSSM: pfam01535
Aligned: 459 rows
Threshold Bit Score: 29.3557
Threshold Setting Gi: 223635637
Created: 15-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30
                  ....*....|....*....|....*....|.
gi 223635621  274 YLFTTAINAFCKGGKVEEAVKLFSKMEEAGV 304
gi 75100043   147 RVSGALVKAYVSLGMFDEATDVLFQSKRLDC 177
gi 75158748   356 VSYNALMGAYAVHGMSGTALSVLGDIKQNGI 386
gi 75216848    89 FSYNALLIAYTSREMYFDAFSLFLSWIGSSC 119
gi 223635625  489 TSFSSLVMAYVKHGMVDDCLGLLREKKWRDS 519
gi 75219588   139 SVYNSLMSVYMWNGLAEECQSLFKDFRRQTH 169
gi 75268024   149 SVYNALMGAYLCNGLSHHCEQLFLDFNSQQD 179
gi 75100645   209 VLWNALVSSYVLNGMIDEAFGLLKLMGSDKN 239
gi 218546778   98 ASVNAAVSGLLENGFCRDAFRMFGDARVSGS 128
gi 758993662  589 YSYGTLMGMAAVRGDLSFALVLFNAAKADGI 619
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap