Conserved Protein Domain Family
PPR

?
pfam01535: PPR 
PPR repeat
This repeat has no known function. It is about 35 amino acids long and found in up to 18 copies in some proteins. This family appears to be greatly expanded in plants. This repeat occurs in PET309 that may be involved in RNA stabilisation. This domain occurs in crp1 that is involved in RNA processing. This repeat is associated with a predicted plant protein that has a domain organisation similar to the human BRCA1 protein. The repeat has been called PPR.
Statistics
?
PSSM-Id: 366695
View PSSM: pfam01535
Aligned: 458 rows
Threshold Bit Score: 27.8146
Threshold Setting Gi: 75219588
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9ZUE9 104 WTYNLLTRSLCKAGLHDLAGQMFECMKSDGV 134 thale cress
Q9ZU67 103 TFLSTLIRSYGRASMFDHAMKMFEEMDKLGT 133 thale cress
O82178 156 ICFNLLIDAYGQKFQYKEAESLYVQLLESRY 186 thale cress
Q8GWE0 281 VTFSTLIRIYGVSGNYDGCLNIYEEMKALGV 311 thale cress
O64624 492 DTFNTLISAYGRCGSEVDASKMYGEMTRAGF 522 thale cress
Q8GWE0 246 VTMAAMIDAYGRAGNVDMALSLYDRARTEKW 276 thale cress
O65567 385 TSYRSMIEGWGRADNYEEAKHYYQELKRCGY 415 thale cress
O82178 370 ASYNIMVDAYGRAGLHSDAEAVFEEMKRLGI 400 thale cress
Q8GWE0 351 STYAALVRAYGRARYGDDALAIYREMKEKGL 381 thale cress
O65567 559 HITSTMIDIYTVMGEFSEAEKLYLNLKSSGV 589 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap