3J9T


Conserved Protein Domain Family
V_ATPase_I

?
pfam01496: V_ATPase_I 
Click on image for an interactive view with Cn3D
V-type ATPase 116kDa subunit family
This family consists of the 116kDa V-type ATPase (vacuolar (H+)-ATPases) subunits, as well as V-type ATP synthase subunit i. The V-type ATPases family are proton pumps that acidify intracellular compartments in eukaryotic cells for example yeast central vacuoles, clathrin-coated and synaptic vesicles. They have important roles in membrane trafficking processes. The 116kDa subunit (subunit a) in the V-type ATPase is part of the V0 functional domain responsible for proton transport. The a subunit is a transmembrane glycoprotein with multiple putative transmembrane helices it has a hydrophilic amino terminal and a hydrophobic carboxy terminal. It has roles in proton transport and assembly of the V-type ATPase complex. This subunit is encoded by two homologous gene in yeast VPH1 and STV1.
Statistics
?
Aligned: 258 rows
Threshold Bit Score: 627.21
Threshold Setting Gi: 523778760
Created: 24-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3J9T_b                    32 TLGQLGLVQFRDLNSkvRAFQRTFVNEIRRLDNVERQYRYFYSLLKKhDIKLYEGDTd------------kYLDGsgely 99  Sac...
EFC40495                  39 RLGELGYVEFKDLSShlNAFQRQFANEVKRCEELDRIIRFFEDQIEK-SEVK---------------------------- 89  Nae...
EFC36897                  54 RLGQLGLVEFKDLSShlNGFQRHYANEVKRCEDLERIIRFFEQEM---EKSNVKFV----------------EES----- 109 Nae...
Q57VD3                    33 KLGQLAAFQFIDLNSdvSAFQRDFVQEVRRCDGMERKLRYLHDEIEKaGLTCVS-------------------TE----- 88  Try...
CAM68294                  33 KLGEIGQFQFEDLNRdvSAFQRDFVQEVRRCDDMERKLRFLQEEIEKaGVTTIV-------------------DG----- 88  Lei...
CAM42896                  35 EIGMLGRVQFLDMNQgvTAFARPFTEELRRCEELQRKLHFIEESMRK-DVALLEKY----------------PTD----- 92  Lei...
WGS:AAFB:cds.EHI_107280A  28 RIGKLGIIQFIDLNDnlASFDRRFINEIKRCEEIERIIRIFEETISFeESRDGFNKIfkrnslavdllpiaTADA----- 102 Ent...
EPR78787                  37 DLGNEEIIHFTNLNKkiSNEDLLFNKQIMYVEKYKSRLLFMMDELEKlEIEVGD--------------------Q----- 91  Spr...
EAX96726                  30 EIAENGKIQLVDNNSgnATMNKRYTEVYLQCEEATRSLSFMKSQLQAaKKLPPQPTLh-------------HALH----- 91  Tri...
EAX97446                  31 LLAEKDLIHLIDENTgnDSVNKRYTESYIHCEEAERCLNFIGNQLEQyDLLPPPITLas-----------fNEQA----- 94  Tri...
3J9T_b                   100 vPPSGSVIDDY------------VRNASYLEERLIQMEDATDQIEVQKNDLEQYRFILQSGDEFFLkgdntds------- 160 Sac...
EFC40495                  90 -FSEGADFNDEetneygnvldsfERDFSQHEKELRDLSGNLDQMVAEKNKAEEYSYVLNLAAQFFKgdeesysgdse--- 165 Nae...
EFC36897                 110 -DKMNGDVNELqegsvn-lldryEREFVKLEAELRNLSDGIEQLVSQKSKAEEFLQVIELAGNLDGeaseesqsga---- 183 Nae...
Q57VD3                    89 -AIGRESLFAL------------EHKIDEYEGELRELNGQYQSLLEESNRTQEHLEVLSR--EFGSgirqs--------- 144 Try...
CAM68294                  89 -GAEGETMSSL------------EHKIDEVYSEVVELNEQYQALIEERNRSKEHLEILSR--DFGGstgd---------- 143 Lei...
CAM42896                  93 -INMSATVEEMqssllrsqmhmiDDRIESTVNDLTAMLTSLEGFQHEMNQNQEMTLLYYKYQLLVEtppvsiasnssfah 171 Lei...
WGS:AAFB:cds.EHI_107280A 103 -QQSELSSEQL------------ILKIRTFDNDLKQLTSDVAAAERAVSGIHEAISLSEHINELIGqdidqt-------- 161 Ent...
EPR78787                  92 -NVKEMEIERV------------YMELEKKYNIFMELNEIKKETKANMELLSEIHKILEETEAFLGvnsnaeleti---- 154 Spr...
EAX96726                  92 -ASHGMTLQEV------------VNAILQADTELREKSTMYERIKDQLRQLKEKQNLL----EFYIpnldsddaqdrsev 154 Tri...
EAX97446                  95 -QNRDISENEL------------RQQIIEADTSLHERITRTQHLEAQLQTAEHTLAAL----RFYRpllqerrnaiqgge 157 Tri...
3J9T_b                   161 ---tsymdedMIDANGENIAaaIgAsvNYVTGVIARDKVATLEQILWRVLRGNLFFKTVEIEQpvydvk-treykhKNAF 236 Sac...
EFC40495                 166 ------------sglmvsrgssL----GYLTGVIPREKISTFLMLIYRSTRGNVVPRMVEIPTplfdak-sgksieKSVF 228 Nae...
EFC36897                 184 sssmlnresqMSS---------L----GCLTGVIPSEKVSAFNMLIYRSTRGNAIPKLYEISSpiydsk-lgktvsKLVF 249 Nae...
Q57VD3                   145 ------------------------pglnlLTGVIPKDRIATLERLVYRITRGNSVLHTDEITTpfsege-kermvqKCVF 199 Try...
CAM68294                 144 -------------------------gvlmVTGVIPKERIPLFERLVYRSTRGNSIMRTDNIDKpfynin-anepvyKSVF 197 Lei...
CAM42896                 172 rgaavtseafSRLSS--------------LFGIIDTTLSEELYRLCYRITRGNAIVEINNEPAmfvdvqtgkrnvaKTTF 237 Lei...
WGS:AAFB:cds.EHI_107280A 162 ----------------------taqtlkYLIGTIDTSKWEALRMVIWRVSRGFVVTRSAPIDNr------------KTGF 207 Ent...
EPR78787                 155 -------------eknnmknikLhV--KFIPGIIDREKAMMLNKVLIGAMRRNVIINSKEVTVng---------keKIFF 210 Spr...
EAX96726                 155 sestrslpynDNMEMQSFNN--L-P--S-CTGYVANESIARLQKIILRVTRRNAVIHFGESNSk------------QTPF 216 Tri...
EAX97446                 158 sdgerssafeMELIGGSS----FlF--S-ITGVIDSSKLRRLLYTFYRISRGNVF-SSSDISTfd---------dqKSFF 220 Tri...
3J9T_b                   237 IVFSHGDLIIKRIRKIAESLDANLYD-VDSSNEGRSQQLAKVNKNLSDLYTVLKTTSTTLESELYAIAKELDSWFQDVTR 315 Sac...
EFC40495                 229 TVFFGASSAKEKVKKVCEALGASIHD-FPEDDVAGAQR--SVQQKINELDTTIESSKLRVVDILSKISVNLPRWKERVHK 305 Nae...
EFC36897                 250 TVFFGSSTAKEKIKKICEAMGATIYD-IPSDETPGESSK-KVNQQVRELEMTIENSKSRLLDLLSEIASNMSEWNNNVFR 327 Nae...
Q57VD3                   200 GVYFATPRLWESLKRISEVNGASLYP-YAESTERLQYMRDTLNSQLETMKHTLQQSLLRQRHLLTSISHNVCQWRQTVAV 278 Try...
CAM68294                 198 AVYFSAPRLRERLIKIAEANAATVYS-YADSEQQLTRMHASLQQQVDTITQTLNQSAYRQRQVLLGIAAACYEWRRAVVT 276 Lei...
CAM42896                 238 VVLCASATMITRLRKLMSGLGANVYS-LDEVQSRGIEL--TTSTTAHHVEDTVEGVKRRKHDVLTQWYEEHRLYKTYLKV 314 Lei...
WGS:AAFB:cds.EHI_107280A 208 VVFIQGDEVLNKLNQICLTSSARIFDsMPIDVIERINYVNEKRQELNELTEVLNGALEAKRQCLRLIASDINIWNEVIER 287 Ent...
EPR78787                 211 IIFTHGESSLYRAKEICLSLGARIIDpLDKRFNKDEKSLLSISSLISQLEVVQKNNISAIKNEAIAISNKIYTYKYFIER 290 Spr...
EAX96726                 217 LVFVSSSVALQKIKAIAQSFSKNVYE-FPTQMEEITRLRNELNGEISQTRSIAIQARSDNLRYLDEVAVHFWDWDARIVR 295 Tri...
EAX97446                 221 TIWFPTESILRKLMNIAQSYGAEVFE-FPAEDSNLDKLENELTNQIYESKSVLRQSYGDNKNFLLQQQQTYWFNRLFYIR 299 Tri...
3J9T_b                   316 EKAIFEILNKSnyDTNRKILIAEGWIPRDELATLQARLGEMIaRLgIDVPSIIQVLD-Tnh----tP----PTFHRTNKF 386 Sac...
EFC40495                 306 EKAIFHTLNLFnyDIKGSV-VAVGWAAEKNFENVKREMEEARlASnAQVPSICDIVQpTe-----tP----PTYFETNKF 375 Nae...
EFC36897                 328 EKAIYHTLNMFnyDIRNSV-VALGWVAERHVETVRREMEQAMfEMhVEIPTLVDIIH-Tde----tP----PTFFETNKF 397 Nae...
Q57VD3                   279 EKSVFSTMNMLk--fSGSTAVAKGWAPVRSLDRIRASLQEAEyLSgAQVLTIVEEIS-Tke----kR----PTCFFTNKF 347 Try...
CAM68294                 277 EKAVFSTMNMLk--fSGSTAIARGWAPVRSCEDIRTAIAEAEyLSgAQVATIIEELN-Tre----tP----PSYFKTNKI 345 Lei...
CAM42896                 315 EKVVLTTMNMCa--mSGSTCTASAWVPLRHEQALRRALQDAVaSAnGSVESIV-----TlhneqqhP----PTFFETTRF 383 Lei...
WGS:AAFB:cds.EHI_107280A 288 ERQVYFTLNMFyvDEGHSHLCGEGWFPTDQFSEINRALEEIE----GPVKPLFGVIQpH-------PnaipPTYIPTTSF 356 Ent...
EPR78787                 291 EIKLYKTMNFLk-iSSGESVVGEAWIRKSQLNELDKIINFIGkSHgRIAYEIVSHRDlT-------P----PTFIKTNAI 358 Spr...
EAX96726                 296 ESQIWSTIDFGdfSRDEGYVYYNGWMPRRYINELGPLAERAThNAnSPVPIRTNNTQaEaqq--reP----PTFIETNNF 369 Tri...
EAX97446                 300 EKQIYQYLDFAdfKTIEDRAIYKGWIAKRRVAEIQPLVDQAQeISgCAIHTTVEFDSvTe-----tP----PTYVETNSF 370 Tri...
3J9T_b                   387 TAGFQSICDCYGIAQYREINAGLPTIVTFPFMFAIMFGDMGHGFLMTLAALSLVLNEKKINKM-KRG--EIFDMAFTGRY 463 Sac...
EFC40495                 376 TDVFQQIVNSYGIPDYKEMNPAVAAVILFPFLFAVMFGDFGHGILLAAAAIAMVVFEKKLKPIaENS--ELLAMVFQGRY 453 Nae...
EFC36897                 398 TEVFQQIVNSYGIPNYKEMNPAVASVIFFPFLFSVMFGDFGHGLLLSIFSFCMIIFERRLKPIaENN--ELLAMIFQGRY 475 Nae...
Q57VD3                   348 TVCFQSIVDSYGMARYKEVNPGVLTIVTFPYLFGIMYGDIGHGVMLTLFAAFLLIKEKDWEGR-KLN--EIFAMIFDGRY 424 Try...
CAM68294                 346 TGSFQSIVDSYGMARYKEANPGVFTIITFPYLFGVMYGDVGHGIILTLFAAFLVFKEKSLEGQ-PLN--EIFAMIFGGRY 422 Lei...
CAM42896                 384 TESFQSIVDSYGMARYKEINPGVFTIITFPYLFGIMYGDIGHGFLLLFIALFFVSKEKAWRTA-QLN--EIVAMVFGGRY 460 Lei...
WGS:AAFB:cds.EHI_107280A 357 SQCSQDLCDSYSIPKYGEVNPGFLYIITFPFLFGVMFGDIGHGIIVFLFALLMIIFQKKIELT-KRN--EIFDMLFGARW 433 Ent...
EPR78787                 359 TQSFQDMTDIFGVPSYKEYNAATFSIFTFPFLYASMFGDVGHGLILTLIGIFLIYRYNAMKGKq-----EILDMLLNGRY 433 Spr...
EAX96726                 370 QYSFQLFNDAYGVPNYNEINAGAFYCM-YPFLFGIMFGDMGHSIFYLLVTLGMFIMVPLMKKK-GNSmgGMLEMIDRFKW 447 Tri...
EAX97446                 371 TYAFQLFNDSYGVACHNEVNGGAFYCM-YPFLFGIMFGDMGHSLLYLIIAISLLLISPKLRAA--GG--ETNDMILNFRW 445 Tri...
3J9T_b                   464 IILLMGVFSMYTGFLYNDIFSKTMTIFKSGWKW--PdhwkkgesitatsvgTYP----------------IGLDWAWHGT 525 Sac...
EFC40495                 454 ILVLMGLFSIYTGFLYNDGLGLAVDIFPSAYEFnsehvg-------ekigrTYP----------------FGVDPAWFHT 510 Nae...
EFC36897                 476 ILILMGLFSIYTGFLYNDGFGLSVDLFPTAFNFdqngig------hkdesrTYP----------------FGIDPGWFHT 533 Nae...
Q57VD3                   425 LLLLMGLFAIYVGFLYNDFFGFSVDTFRSGYQWpplngn-------tqegdMQPsspsgvt---parsviFGIDSAWAET 494 Try...
CAM68294                 423 LLLLMGFFAVYMGLLYNDMFGFSIEIFASGYRWpqlppe-------gpdgiVYPsfptgrpsvkpespviFGIDSAWSET 495 Lei...
CAM42896                 461 LLLLMSLFAIYMGVLYNDFFGFSLNLFSSGYTWapiae---------qngtTYPttpsglpsvkpphvytMGLDAAWAET 531 Lei...
WGS:AAFB:cds.EHI_107280A 434 MILLMGLFSIYCGALYNEFFGIAIDLFGTSWNKenGlfyer-----snpnyVYP----------------FGVDPIWKSS 492 Ent...
EPR78787                 434 MMLFAGLYSIYFGFLYSECISTPLSLFPSQYSEsgskyi-------rkggyIYP----------------FGIDPVWHHS 490 Spr...
EAX96726                 448 FLLFASVCSFYCGFLYNETFCLPINFFGSHYHVddrnsnpqltvykknstsIYP----------------FGLDPAWFFK 511 Tri...
EAX97446                 446 FLFFMSICAFYCGFVYNECFGLPIDFFGSSYVEgtkegkkv---wtqkpnkVYP----------------FGVDPVWMFK 506 Tri...
3J9T_b                   526 ENALLFSNSYKMKLSILMGFIHMTYSYFFSLANHLYFNSMIDIIGNFIPGLLFMQGIFGYLSVCIVYKWAVDWvkD---- 601 Sac...
EFC40495                 511 SNKLLFYNSIKMKMSVIFGVGHMSIGLFFALANMIQFGHFLDIFVEFIPEVLILWCTFGYMCVLIVYKWCVNWg-Devhs 589 Nae...
EFC36897                 534 SNKLLFYNSLKMKMAIIFGVGHMTAGLLFSLVNMIQFGHFLDIFLEFIPELLILWCTFGYMSIMIVYKWCVNWg-Det-h 611 Nae...
Q57VD3                   495 ENKLEFYNSVKMKCSVIIGVVQMVAGVILSLMNHIYFGDRIQIWFRFVPEIVFLLCTFGYMCVLIIIKWCTNWd-Q---- 569 Try...
CAM68294                 496 ENKLEFYNSIKMKCSVIIGVAQMMAGVFISLTNYIYFNDSVKVWFRFVPEVVFLSCTFGYMCVLIIVKWLTTWe------ 569 Lei...
CAM42896                 532 DNKLEFYNSVKMKHAVIVGVAQMLAGLLLSLSNSIYEKNWYKVGFLFVPEFLFLLCTFGYMSILIMVKWCCTWe------ 605 Lei...
WGS:AAFB:cds.EHI_107280A 493 NNELYFYNSLKMKMSILIGVTHMTIGIWISLINHIHYKNLINVVFQFLPEIIFMSCTFGYLCFLILIKWMFFIe------ 566 Ent...
EPR78787                 491 KEGSDFSNNLKMKLSVVIGFFHMSLGLVIAFMNSSYKNNKSKMLFQDLPKLLSFYSVIGYMIFLIFFKYVTAI------- 563 Spr...
EAX96726                 512 DNELIFSNSLKMKMSVIVGMAQMIFGLILSFINNFVQRDWVSLITLRVPELLYLVPFYGYMVVIIIWKWCTNFk------ 585 Tri...
EAX97446                 507 DNELTFTNSLKMKLAIIMGFCQMAFGMVLQFIKHYHRRDWLELCLSWLPQMLYMFSFFGYMVFLIIFKWCSHH------- 579 Tri...
3J9T_b                   602 GKP-APG------------LLNMLINMFLSPGTI-----DDE--LYPH---------QAKVQVFLLLMALVCIPWLLLVK 652 Sac...
EFC40495                 590 GKFdPPQ------------ILPMMTDYFLSPWKM-----SQPpmFYYGgdvaeaqarQSYAQMALLLITAISVPILLIPK 652 Nae...
EFC36897                 612 VNIeIPQ------------LLPTMTDFFLSPWKM-----SQPplFYFGgsveeaqkkQTYAQLTLLLIAVISVPILLIPK 674 Nae...
Q57VD3                   570 RTSeAPS------------LLETMTNFFLQPGTV-----NVP--LYKG---------QEFVQVLLLLIAFAMVPILLCAI 621 Try...
CAM68294                 570 NTHdAPS------------LLETMTNFFLAPGTI-----TLP--LFSG---------QAALQVMLLLVSLACVPCMLCVI 621 Lei...
CAM42896                 606 NTNkAPS------------ILEIMTNFFLQPGSV-----PNP--LFRG---------QAALQVFLLLLAFVMVPFMLLGM 657 Lei...
WGS:AAFB:cds.EHI_107280A 567 --D-APM------------ITNVFLEMFQNFGIV-----TEPnhMFWG---------QSFIEPILFIFTVLSVIAMMVPK 617 Ent...
EPR78787                 564 ----DQS------------IMSIVVSMFTPPFKV-----EEP--IYPG---------QIIIQRIIVAVFLISVISFHISQ 611 Spr...
EAX96726                 586 --G-NPSlynvnvqkdginLIQVMIGMILSFGSE-----DDDlkLYEG---------QWGAQAVITTIFFCSIPVFLVLR 648 Tri...
EAX97446                 580 ----TPGedg-------vnLIQVLIGMLLSAGDKidkgsESY--LYPH---------QKTVQNVIALIFIITIPVLLFAK 637 Tri...
3J9T_b                   653 PL--HFKFTHKKK---SHEPLPSTE-------------------------------------------------A----- 673 Sac...
EFC40495                 653 PIaeYLKQKRKFKhrkVDD------------------------------------------------------------- 671 Nae...
EFC36897                 675 PV--IEYYKQKRKlkkV--------------------------------------------------------------- 689 Nae...
Q57VD3                   622 PM--HEKKEHERKmrlQ--------------------------------------------------------------- 636 Try...
CAM68294                 622 PY--VEKKEHDHKmqeR--------------------------------------------------------------- 636 Lei...
CAM42896                 658 PY--IEMRDYKRWkqrRHVGGGRHYggsqrasmitienadfsdv-----------ffneppvsrqhrsycdsgdErahrs 724 Lei...
WGS:AAFB:cds.EHI_107280A 618 PI--LLYVLKKKDqkrSENGQGQDNyyqpfnqenndfitedirqenndipylpnendgyivannnieemqeqfeNedrvs 695 Ent...
EPR78787                 612 PI--YLIIQGAKds------------------------------------------------------------------ 623 Spr...
EAX96726                 649 PC--FEAYLHHGdpnw---------------------------------------------------------------- 662 Tri...
EAX97446                 638 PI--VEIVCHKGkahg---------------------------------------------------------------- 651 Tri...
3J9T_b                   674 ------------DASSEDLEAQQLisamdaddaeeee----------vgsgshgedfgdIMIHQVIHTIEFCLNCVSHTA 731 Sac...
EFC40495                 672 -----------------AEVVNSNsdeshhvaildgtdghdnvahthgeghaemepfseLFIKQLIHTIEYVLGTVSNTA 734 Nae...
EFC36897                 690 -------------------LESEPvlsnseeesheikld-----etkvtnhaeiepfseLFIKQLIHTIEYVLNTVSNTA 745 Nae...
Q57VD3                   637 -------------------ALARRnederhegsedd------------ydedekfdfseVVIHQVIHTIEYVLGCVSNTA 685 Try...
CAM68294                 637 -------------------AAHPPedgeeeee--------------------ddfqfseIIIHQIIHTIEYVLGCVSNTA 677 Lei...
CAM42896                 725 lm----sdddtaAPPAANIFFDDDsmhpfggapsdseggataqviqnenekfenfdvseLIIHYAIHTIEYVLSSVSNTA 800 Lei...
WGS:AAFB:cds.EHI_107280A 696 llgnenksikkeNLLSEESKISKIlklikkknpnytfdekewirvkydpddengnnlleIIIFNTIHAVEFILGCISNTA 775 Ent...
EPR78787                 624 ---------------------------------------------------------ldLFLHYVIEGIEFAIGLISHIS 646 Spr...
EAX96726                 663 -------------------------------------------------------svleAIVMNLIHVIEFVLQALSHTA 687 Tri...
EAX97446                 652 -------------------------------------------------------gvmeIFVMNLIDVIEFCLSMLSHTA 676 Tri...
3J9T_b                   732 SYLRLWALSLAHAQLSSVLWTMTIQIaF----------Gfrgf----------vgvFMTVALFA-MWFALTCAVLVLMEG 790 Sac...
EFC40495                 735 SYLRLWALSLAHAQLAEVFWQMTIGLiLnqlesmpeveTavv-----------hsgVGVFFVFA-LWFGMTIGVLLVMES 802 Nae...
EFC36897                 746 SYLRLWALSLAHAQLSEVFWQMTLGIlLnslesyplleDilv-----------hygIGVFFLCA-LWFGMTIGVLLIMES 813 Nae...
Q57VD3                   686 SYLRLWALSLAHSQLSEVFWSFTFLMaLdm------dkGs---------------gVFVFFGLC-VWMCATVAVLLGMES 743 Try...
CAM68294                 678 SYLRLWALSLAHSQLSEVFWSFAFLLtVdy------dsGt---------------gICIFFGFA-VWMAATIGVLLGMES 735 Lei...
CAM42896                 801 SYLRLWALSLAHAQLSEVFFNFAVVQtLnv------dnSs---------------gLVIAIGVL-LWLGATLGVLVGMEA 858 Lei...
WGS:AAFB:cds.EHI_107280A 776 SYLRLWALSLAHAQLGSVFLEYVFYTlLef------nnF-----------------FLTFVGFA-LFALITLGILIGMES 831 Ent...
EPR78787                 647 SYLRIWAVSLAHYQLGNILFSYLIDV------------S-----------------WMYYIVTVpLWALFTFFLIMALEG 697 Spr...
EAX96726                 688 SYLRLWALSLAHSQLSKVIWEELF---L----------NgfnyskthdgpwtngtwVLTFFVFL-AFTVMTAAILLGMEA 753 Tri...
EAX97446                 677 SYLRLWALSLAHSQLSHVLYEQIFIL-Tl---------Kqyn-------------paLFFCGWA-AFAVGTVVILLGMEC 732 Tri...
3J9T_b                   791 TSAMLHSLRLHWVESMSKFFVGEGLPYEPFAF 822 Saccharomyces cerevisiae S288C
EFC40495                 803 LSAFLHALRLTWVEFQNKFFKGTGSLFRPFSF 834 Naegleria gruberi
EFC36897                 814 LSAFLHAIRLTWIEFQGKFFGGTGSLFQPFSF 845 Naegleria gruberi
Q57VD3                   744 LSAFLHALRLHWVEFNNKFYAADGYPFTPFNi 775 Trypanosoma brucei
CAM68294                 736 LSAFLHALRLHWVEFNNKFYAADGHAFEPFDl 767 Leishmania infantum JPCM5
CAM42896                 859 LSAFLHALRLHWVEFQSKFYAGDGRAFDPmdl 890 Leishmania braziliensis MHOM/BR/75/M2904
WGS:AAFB:cds.EHI_107280A 832 LSAFLHTLRLHWVEFQNKFYLGDGIKFVPFKl 863 Entamoeba histolytica HM-1:IMSS
EPR78787                 698 VSTALHAMRLNWIEFNSKFYEGEGYSFRPLQF 729 Spraguea lophii 42_110
EAX96726                 754 FSALLHGIRLMWVEFCSKFYGGGGYEFKPVSl 785 Trichomonas vaginalis G3
EAX97446                 733 FSSLLHAIRLMWVEFSSKFYTGQGYEFKPLSF 764 Trichomonas vaginalis G3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap