6VQ6,6O7T,6O7U


Conserved Protein Domain Family
V_ATPase_I

?
pfam01496: V_ATPase_I 
V-type ATPase 116kDa subunit family
This family consists of the 116kDa V-type ATPase (vacuolar (H+)-ATPases) subunits, as well as V-type ATP synthase subunit i. The V-type ATPases family are proton pumps that acidify intracellular compartments in eukaryotic cells for example yeast central vacuoles, clathrin-coated and synaptic vesicles. They have important roles in membrane trafficking processes. The 116kDa subunit (subunit a) in the V-type ATPase is part of the V0 functional domain responsible for proton transport. The a subunit is a transmembrane glycoprotein with multiple putative transmembrane helices it has a hydrophilic amino terminal and a hydrophobic carboxy terminal. It has roles in proton transport and assembly of the V-type ATPase complex. This subunit is encoded by two homologous gene in yeast VPH1 and STV1.
Statistics
?
Aligned: 238 rows
Threshold Bit Score: 639.14
Threshold Setting Gi: 523778760
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6VQ6_AA                   27 SELEELGKVQFRDLNPdvNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKaNIPIM---Dt------------gENPEVPFP 91 
EFC40495                  38 ERLGELGYVEFKDLSShlNAFQRQFANEVKRCEELDRIIRFFEDQIEK-SEVK-----------------------FSEG 93  Nae...
EFC36897                  53 ERLGQLGLVEFKDLSShlNGFQRHYANEVKRCEDLERIIRFFEQEM---EKSNVkf----------------vEESDKMN 113 Nae...
Q57VD3                    32 lKLGQLAAFQFIDLNSdvSAFQRDFVQEVRRCDGMERKLRYLHDEIEKaGLTCVs-------------------TEAIGR 92  Try...
CAM68294                  32 lKLGEIGQFQFEDLNRdvSAFQRDFVQEVRRCDDMERKLRFLQEEIEKaGVTTIv-------------------DGGAEG 92  Lei...
XP_001567458              34 YEIGMLGRVQFLDMNQgvTAFARPFTEELRRCEELQRKLHFIEESMRK-DVALLek----------------yPTDINMS 96  Lei...
WGS:AAFB:cds.EHI_107280A  27 ERIGKLGIIQFIDLNDnlASFDRRFINEIKRCEEIERIIRIFEETISFeESRDGfnkIfkrnslavdllpiaTADAQQSE 106 Ent...
EPR78787                  36 TDLGNEEIIHFTNLNKkiSNEDLLFNKQIMYVEKYKSRLLFMMDELEKlEIEVGd--------------------QNVKE 95  Spr...
XP_001309656              29 QEIAENGKIQLVDNNSgnATMNKRYTEVYLQCEEATRSLSFMKSQLQAaKKLPPqptLh-------------HALHASHG 95  Tri...
XP_001310376              30 RLLAEKDLIHLIDENTgnDSVNKRYTESYIHCEEAERCLNFIGNQLEQyDLLPPpitLas-----------fNEQAQNRD 98  Tri...
6VQ6_AA                   92 RDMIDL------------EANFEKIENELKEINTNQEALKRNFLELTELKFILRKTQQFFdemadpdlleesssl----- 154
EFC40495                  94 ADFNDEetneygnvldsfERDFSQHEKELRDLSGNLDQMVAEKNKAEEYSYVLNLAAQFFkgdeesysgdse-------- 165 Nae...
EFC36897                 114 GDVNELqegsvn-lldryEREFVKLEAELRNLSDGIEQLVSQKSKAEEFLQVIELAGNLDgeaseesqsgass------- 185 Nae...
Q57VD3                    93 ESLFAL------------EHKIDEYEGELRELNGQYQSLLEESNRTQEHLEVLSR--EFGsgirqs-------------- 144 Try...
CAM68294                  93 ETMSSL------------EHKIDEVYSEVVELNEQYQALIEERNRSKEHLEILSR--DFGgstgd--------------- 143 Lei...
XP_001567458              97 ATVEEMqssllrsqmhmiDDRIESTVNDLTAMLTSLEGFQHEMNQNQEMTLLYYKYQLLVetppvsiasnssfah----- 171 Lei...
WGS:AAFB:cds.EHI_107280A 107 LSSEQL------------ILKIRTFDNDLKQLTSDVAAAERAVSGIHEAISLSEHINELIgqdidqt------------- 161 Ent...
EPR78787                  96 MEIERV------------YMELEKKYNIFMELNEIKKETKANMELLSEIHKILEETEAFLgvnsnaeletie-------- 155 Spr...
XP_001309656              96 MTLQEV------------VNAILQADTELREKSTMYERIKDQLRQLKEKQNLL----EFYipnldsddaqdrsevsestr 159 Tri...
XP_001310376              99 ISENEL------------RQQIIEADTSLHERITRTQHLEAQLQTAEHTLAAL----RFYrpllqerrnaiqggesdge- 161 Tri...
6VQ6_AA                  155 --lepnemgrgaplrlgFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENpledpv-tgdyvhKSVFIIFFQGDQLKN 231
EFC40495                 166 -----sglmvsrgsslgYLTGVIPREKISTFLMLIYRSTRGNVVPRMVEIPTplfdak-sgksieKSVFTVFFGASSAKE 239 Nae...
EFC36897                 186 ----smlnresqmsslgCLTGVIPSEKVSAFNMLIYRSTRGNAIPKLYEISSpiydsk-lgktvsKLVFTVFFGSSTAKE 260 Nae...
Q57VD3                   145 -------------pglnlLTGVIPKDRIATLERLVYRITRGNSVLHTDEITTpfsege-kermvqKCVFGVYFATPRLWE 210 Try...
CAM68294                 144 --------------gvlmVTGVIPKERIPLFERLVYRSTRGNSIMRTDNIDKpfynin-anepvyKSVFAVYFSAPRLRE 208 Lei...
XP_001567458             172 ---rgaavtseafsrlssLFGIIDTTLSEELYRLCYRITRGNAIVEINNEPAmfvdvqtgkrnvaKTTFVVLCASATMIT 248 Lei...
WGS:AAFB:cds.EHI_107280A 162 -----------taqtlkYLIGTIDTSKWEALRMVIWRVSRGFVVTRSAPIDNr------------KTGFVVFIQGDEVLN 218 Ent...
EPR78787                 156 -----knnmkniklhvkFIPGIIDREKAMMLNKVLIGAMRRNVIINSKEVTVng---------keKIFFIIFTHGESSLY 221 Spr...
XP_001309656             160 slpyndnmemqsfnnlpsCTGYVANESIARLQKIILRVTRRNAVIHFGESNSk------------QTPFLVFVSSSVALQ 227 Tri...
XP_001310376             162 rssafemeliggssflfsITGVIDSSKLRRLLYTFYRISRGNVF-SSSDISTfd---------dqKSFFTIWFPTESILR 231 Tri...
6VQ6_AA                  232 RVKKICEGFRASLYP-CPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVRKMKAIYHTLNLC 310
EFC40495                 240 KVKKVCEALGASIHD-FPEDDVAGAQR--SVQQKINELDTTIESSKLRVVDILSKISVNLPRWKERVHKEKAIFHTLNLF 316 Nae...
EFC36897                 261 KIKKICEAMGATIYD-IPSDETPGESSK-KVNQQVRELEMTIENSKSRLLDLLSEIASNMSEWNNNVFREKAIYHTLNMF 338 Nae...
Q57VD3                   211 SLKRISEVNGASLYP-YAESTERLQYMRDTLNSQLETMKHTLQQSLLRQRHLLTSISHNVCQWRQTVAVEKSVFSTMNML 289 Try...
CAM68294                 209 RLIKIAEANAATVYS-YADSEQQLTRMHASLQQQVDTITQTLNQSAYRQRQVLLGIAAACYEWRRAVVTEKAVFSTMNML 287 Lei...
XP_001567458             249 RLRKLMSGLGANVYS-LDEVQSRGIEL--TTSTTAHHVEDTVEGVKRRKHDVLTQWYEEHRLYKTYLKVEKVVLTTMNMC 325 Lei...
WGS:AAFB:cds.EHI_107280A 219 KLNQICLTSSARIFDsMPIDVIERINYVNEKRQELNELTEVLNGALEAKRQCLRLIASDINIWNEVIERERQVYFTLNMF 298 Ent...
EPR78787                 222 RAKEICLSLGARIIDpLDKRFNKDEKSLLSISSLISQLEVVQKNNISAIKNEAIAISNKIYTYKYFIEREIKLYKTMNFL 301 Spr...
XP_001309656             228 KIKAIAQSFSKNVYE-FPTQMEEITRLRNELNGEISQTRSIAIQARSDNLRYLDEVAVHFWDWDARIVRESQIWSTIDFG 306 Tri...
XP_001310376             232 KLMNIAQSYGAEVFE-FPAEDSNLDKLENELTNQIYESKSVLRQSYGDNKNFLLQQQQTYWFNRLFYIREKQIYQYLDFA 310 Tri...
6VQ6_AA                  311 niDVTQKCLIAEVWCPVTDLDSIQFALRRGTeHSgSTVPSILNRMQ-Tnq----tP----PTYNKTNKFTHGFQNIVDAY 381
EFC40495                 317 nyDIKGSV-VAVGWAAEKNFENVKREMEEARlASnAQVPSICDIVQpTe-----tP----PTYFETNKFTDVFQQIVNSY 386 Nae...
EFC36897                 339 nyDIRNSV-VALGWVAERHVETVRREMEQAMfEMhVEIPTLVDIIH-Tde----tP----PTFFETNKFTEVFQQIVNSY 408 Nae...
Q57VD3                   290 k--fSGSTAVAKGWAPVRSLDRIRASLQEAEyLSgAQVLTIVEEIS-Tke----kR----PTCFFTNKFTVCFQSIVDSY 358 Try...
CAM68294                 288 k--fSGSTAIARGWAPVRSCEDIRTAIAEAEyLSgAQVATIIEELN-Tre----tP----PSYFKTNKITGSFQSIVDSY 356 Lei...
XP_001567458             326 a--mSGSTCTASAWVPLRHEQALRRALQDAVaSAnGSVESIV-----TlhneqqhP----PTFFETTRFTESFQSIVDSY 394 Lei...
WGS:AAFB:cds.EHI_107280A 299 yvDEGHSHLCGEGWFPTDQFSEINRALEEIE----GPVKPLFGVIQpH-------PnaipPTYIPTTSFSQCSQDLCDSY 367 Ent...
EPR78787                 302 k-iSSGESVVGEAWIRKSQLNELDKIINFIGkSHgRIAYEIVSHRDlT-------P----PTFIKTNAITQSFQDMTDIF 369 Spr...
XP_001309656             307 dfSRDEGYVYYNGWMPRRYINELGPLAERAThNAnSPVPIRTNNTQaEaqq--reP----PTFIETNNFQYSFQLFNDAY 380 Tri...
XP_001310376             311 dfKTIEDRAIYKGWIAKRRVAEIQPLVDQAQeISgCAIHTTVEFDSvTe-----tP----PTYVETNSFTYAFQLFNDSY 381 Tri...
6VQ6_AA                  382 GIGTYREINPAPYTVITFPFLFAVMFGDFGHGILMTLfavwmvlres-rilsqkneneMFSMVFSGRYIILLMGLFSIYT 460
EFC40495                 387 GIPDYKEMNPAVAAVILFPFLFAVMFGDFGHGILLAAaaiamvvfek-klkpiaenseLLAMVFQGRYILVLMGLFSIYT 465 Nae...
EFC36897                 409 GIPNYKEMNPAVASVIFFPFLFSVMFGDFGHGLLLSIfsfcmiifer-rlkpiaenneLLAMIFQGRYILILMGLFSIYT 487 Nae...
Q57VD3                   359 GMARYKEVNPGVLTIVTFPYLFGIMYGDIGHGVMLTLfaafllikek--dwegrklneIFAMIFDGRYLLLLMGLFAIYV 436 Try...
CAM68294                 357 GMARYKEANPGVFTIITFPYLFGVMYGDVGHGIILTLfaaflvfkek--slegqplneIFAMIFGGRYLLLLMGFFAVYM 434 Lei...
XP_001567458             395 GMARYKEINPGVFTIITFPYLFGIMYGDIGHGFLLLFialffvskek--awrtaqlneIVAMVFGGRYLLLLMSLFAIYM 472 Lei...
WGS:AAFB:cds.EHI_107280A 368 SIPKYGEVNPGFLYIITFPFLFGVMFGDIGHGIIVFLfallmiifqk--kieltkrneIFDMLFGARWMILLMGLFSIYC 445 Ent...
EPR78787                 370 GVPSYKEYNAATFSIFTFPFLYASMFGDVGHGLILTLigifliyry----namkgkqeILDMLLNGRYMMLFAGLYSIYF 445 Spr...
XP_001309656             381 GVPNYNEINAGAFYCM-YPFLFGIMFGDMGHSIFYLLvtlgmfimvplmkkkgnsmggMLEMIDRFKWFLLFASVCSFYC 459 Tri...
XP_001310376             382 GVACHNEVNGGAFYCM-YPFLFGIMFGDMGHSLLYLIiaislllis---pklraaggeTNDMILNFRWFLFFMSICAFYC 457 Tri...
6VQ6_AA                  461 GLIYNDCFSKSLNIFGSSWSV--RPMFTIgnwtEetllgssvlqlnpaipgvfGGPYP----------------FGIDPI 522
EFC40495                 466 GFLYNDGLGLAVDIFPSAYEFnsehvg-----------------------ekigrTYP----------------FGVDPA 506 Nae...
EFC36897                 488 GFLYNDGFGLSVDLFPTAFNFdqngig----------------------hkdesrTYP----------------FGIDPG 529 Nae...
Q57VD3                   437 GFLYNDFFGFSVDTFRSGYQWpplngn-----------------------tqegdMQPsspsgvt---parsviFGIDSA 490 Try...
CAM68294                 435 GLLYNDMFGFSIEIFASGYRWpqlppe-----------------------gpdgiVYPsfptgrpsvkpespviFGIDSA 491 Lei...
XP_001567458             473 GVLYNDFFGFSLNLFSSGYTWapiae-------------------------qngtTYPttpsglpsvkpphvytMGLDAA 527 Lei...
WGS:AAFB:cds.EHI_107280A 446 GALYNEFFGIAIDLFGTSWNKenGLFYERs--nP-------------------NYVYP----------------FGVDPI 488 Ent...
EPR78787                 446 GFLYSECISTPLSLFPSQYSEsgskyi-----------------------rkggyIYP----------------FGIDPV 486 Spr...
XP_001309656             460 GFLYNETFCLPINFFGSHYHVddrnsnpql----------------tvykknstsIYP----------------FGLDPA 507 Tri...
XP_001310376             458 GFVYNECFGLPIDFFGSSYVEgtkegkkv-------------------wtqkpnkVYP----------------FGVDPV 502 Tri...
6VQ6_AA                  523 WNIATNKLTFLNSFKMKMSVILGIIHMLFGVSLSLFNHIYFKKPLNIYFGFIPEIIFMSSLFGYLVILIFYKWTAYDa-- 600
EFC40495                 507 WFHTSNKLLFYNSIKMKMSVIFGVGHMSIGLFFALANMIQFGHFLDIFVEFIPEVLILWCTFGYMCVLIVYKWCVNWgde 586 Nae...
EFC36897                 530 WFHTSNKLLFYNSLKMKMAIIFGVGHMTAGLLFSLVNMIQFGHFLDIFLEFIPELLILWCTFGYMSIMIVYKWCVNWgd- 608 Nae...
Q57VD3                   491 WAETENKLEFYNSVKMKCSVIIGVVQMVAGVILSLMNHIYFGDRIQIWFRFVPEIVFLLCTFGYMCVLIIIKWCTNWd-- 568 Try...
CAM68294                 492 WSETENKLEFYNSIKMKCSVIIGVAQMMAGVFISLTNYIYFNDSVKVWFRFVPEVVFLSCTFGYMCVLIIVKWLTTWe-- 569 Lei...
XP_001567458             528 WAETDNKLEFYNSVKMKHAVIVGVAQMLAGLLLSLSNSIYEKNWYKVGFLFVPEFLFLLCTFGYMSILIMVKWCCTWe-- 605 Lei...
WGS:AAFB:cds.EHI_107280A 489 WKSSNNELYFYNSLKMKMSILIGVTHMTIGIWISLINHIHYKNLINVVFQFLPEIIFMSCTFGYLCFLILIKWMFFIe-- 566 Ent...
EPR78787                 487 WHHSKEGSDFSNNLKMKLSVVIGFFHMSLGLVIAFMNSSYKNNKSKMLFQDLPKLLSFYSVIGYMIFLIFFKYVTAI--- 563 Spr...
XP_001309656             508 WFFKDNELIFSNSLKMKMSVIVGMAQMIFGLILSFINNFVQRDWVSLITLRVPELLYLVPFYGYMVVIIIWKWCTNFk-- 585 Tri...
XP_001310376             503 WMFKDNELTFTNSLKMKLAIIMGFCQMAFGMVLQFIKHYHRRDWLELCLSWLPQMLYMFSFFGYMVFLIIFKWCSHH--- 579 Tri...
6VQ6_AA                  601 --HSSrN-APS------------LLIHFINMFLFSYPes---gnAM--LYSG---------QKGIQCFLIVVAMLCVPWM 651
EFC40495                 587 vhSGK-FdPPQ------------ILPMMTDYFLSPWKm-----sQPpmFYYGgdvaeaqarQSYAQMALLLITAISVPIL 648 Nae...
EFC36897                 609 etHVN-IeIPQ------------LLPTMTDFFLSPWKm-----sQPplFYFGgsveeaqkkQTYAQLTLLLIAVISVPIL 670 Nae...
Q57VD3                   569 --QRT-SeAPS------------LLETMTNFFLQPGTv-----nVP--LYKG---------QEFVQVLLLLIAFAMVPIL 617 Try...
CAM68294                 570 ---NT-HdAPS------------LLETMTNFFLAPGTi-----tLP--LFSG---------QAALQVMLLLVSLACVPCM 617 Lei...
XP_001567458             606 ---NT-NkAPS------------ILEIMTNFFLQPGSv-----pNP--LFRG---------QAALQVFLLLLAFVMVPFM 653 Lei...
WGS:AAFB:cds.EHI_107280A 567 ------D-APM------------ITNVFLEMFQNFGIv-----tEPnhMFWG---------QSFIEPILFIFTVLSVIAM 613 Ent...
EPR78787                 564 --------DQS------------IMSIVVSMFTPPFKv-----eEP--IYPG---------QIIIQRIIVAVFLISVISF 607 Spr...
XP_001309656             586 ------G-NPSlynvnvqkdginLIQVMIGMILSFGSe-----dDDlkLYEG---------QWGAQAVITTIFFCSIPVF 644 Tri...
XP_001310376             580 --------TPGedg-------vnLIQVLIGMLLSAGDkidkgseSY--LYPH---------QKTVQNVIALIFIITIPVL 633 Tri...
6VQ6_AA                  652 LLFKPL--ILRHQYLRKKHLGTLNFGGIR--------------------------------------------------- 678
EFC40495                 649 LIPKPIaeYLKQKRKFKHRKVDD--------------------------------------------------------- 671 Nae...
EFC36897                 671 LIPKPV--IEYYKQKRKLKKV----------------------------------------------------------- 689 Nae...
Q57VD3                   618 LCAIPM--HEKKEHERKMRLQ----------------------------------------------------------- 636 Try...
CAM68294                 618 LCVIPY--VEKKEHDHKMQER----------------------------------------------------------- 636 Lei...
XP_001567458             654 LLGMPY--IEMRDYKRWKQRRHVGGGRHYggsqrasmitienadfsdvffne-------------ppvsrqhrsycdsgd 718 Lei...
WGS:AAFB:cds.EHI_107280A 614 MVPKPI--LLYVLKKKDQKRSENGQGQDNyyqpfnqenndfitedirqenndipylpnendgyivannnieemqeqfene 691 Ent...
EPR78787                 608 HISQPI--YLIIQGAK---------------------------------------------------------------- 621 Spr...
XP_001309656             645 LVLRPC--FEAYLHHG---------------------------------------------------------------- 658 Tri...
XP_001310376             634 LFAKPI--VEIVCHKG---------------------------------------------------------------- 647 Tri...
6VQ6_AA                  679 -------V--------GNGPTEEDAE----------IIQHDQLSTHSEDAEEPTEDEVFDFGDTMVHQAIHTIEYCLGCI 733
EFC40495                 672 ---------------------AEVVNsnsdeshhvaILDGTDGHDNVAHTHGEGHAEMEPFSELFIKQLIHTIEYVLGTV 730 Nae...
EFC36897                 690 -----------------------LESepv-----lsNSEEESHEIKLDETKVTNHAEIEPFSELFIKQLIHTIEYVLNTV 741 Nae...
Q57VD3                   637 -----------------------ALArr------------nEDERHEGSEDDYDEDEKFDFSEVVIHQVIHTIEYVLGCV 681 Try...
CAM68294                 637 -----------------------AAHpp--------------------eDGEEEEEDDFQFSEIIIHQIIHTIEYVLGCV 673 Lei...
XP_001567458             719 erahrslMsdd--dtaAPPAANIFFDddsmhpfggaPSDSEGGATAQVIQNENEKFENFDVSELIIHYAIHTIEYVLSSV 796 Lei...
WGS:AAFB:cds.EHI_107280A 692 drvsllgNenksikkeNLLSEESKISkilklikkknPNYTFDEKEWIRVKYDPDDENGNNLLEIIIFNTIHAVEFILGCI 771 Ent...
EPR78787                 622 -----------------------------------------------------------DSLDLFLHYVIEGIEFAIGLI 642 Spr...
XP_001309656             659 -------------------------------------------------------DPNWSVLEAIVMNLIHVIEFVLQAL 683 Tri...
XP_001310376             648 -------------------------------------------------------KAHGGVMEIFVMNLIDVIEFCLSML 672 Tri...
6VQ6_AA                  734 SNTASYLRLWALSLAHAQLSEVLWTMVIHI-G---------LHvrsl----------aggLGLFFIFA-AFATLTVAILL 792
EFC40495                 731 SNTASYLRLWALSLAHAQLAEVFWQMTIGLiLnqlesmpevETavv-----------hsgVGVFFVFA-LWFGMTIGVLL 798 Nae...
EFC36897                 742 SNTASYLRLWALSLAHAQLSEVFWQMTLGIlLnslesypllEDilv-----------hygIGVFFLCA-LWFGMTIGVLL 809 Nae...
Q57VD3                   682 SNTASYLRLWALSLAHSQLSEVFWSFTFLMaLdm------dKGs---------------gVFVFFGLC-VWMCATVAVLL 739 Try...
CAM68294                 674 SNTASYLRLWALSLAHSQLSEVFWSFAFLLtVdy------dSGt---------------gICIFFGFA-VWMAATIGVLL 731 Lei...
XP_001567458             797 SNTASYLRLWALSLAHAQLSEVFFNFAVVQtLnv------dNSs---------------gLVIAIGVL-LWLGATLGVLV 854 Lei...
WGS:AAFB:cds.EHI_107280A 772 SNTASYLRLWALSLAHAQLGSVFLEYVFYTlLef------nNF-----------------FLTFVGFA-LFALITLGILI 827 Ent...
EPR78787                 643 SHISSYLRIWAVSLAHYQLGNILFSYLIDV------------S-----------------WMYYIVTVpLWALFTFFLIM 693 Spr...
XP_001309656             684 SHTASYLRLWALSLAHSQLSKVIWEELF---L----------NgfnyskthdgpwtngtwVLTFFVFL-AFTVMTAAILL 749 Tri...
XP_001310376             673 SHTASYLRLWALSLAHSQLSHVLYEQIFIL-T---------LKqyn-------------paLFFCGWA-AFAVGTVVILL 728 Tri...
6VQ6_AA                  793 IMEGLSAFLHALRLHWVEFQNKFYTGTGFKFLPFSF 828
EFC40495                 799 VMESLSAFLHALRLTWVEFQNKFFKGTGSLFRPFSF 834 Naegleria gruberi
EFC36897                 810 IMESLSAFLHAIRLTWIEFQGKFFGGTGSLFQPFSF 845 Naegleria gruberi
Q57VD3                   740 GMESLSAFLHALRLHWVEFNNKFYAADGYPFTPFNi 775 Trypanosoma brucei
CAM68294                 732 GMESLSAFLHALRLHWVEFNNKFYAADGHAFEPFDl 767 Leishmania infantum JPCM5
XP_001567458             855 GMEALSAFLHALRLHWVEFQSKFYAGDGRAFDPmdl 890 Leishmania braziliensis MHOM/BR/75/M2904
WGS:AAFB:cds.EHI_107280A 828 GMESLSAFLHTLRLHWVEFQNKFYLGDGIKFVPFKl 863 Entamoeba histolytica HM-1:IMSS
EPR78787                 694 ALEGVSTALHAMRLNWIEFNSKFYEGEGYSFRPLQF 729 Spraguea lophii 42_110
XP_001309656             750 GMEAFSALLHGIRLMWVEFCSKFYGGGGYEFKPVSl 785 Trichomonas vaginalis G3
XP_001310376             729 GMECFSSLLHAIRLMWVEFSSKFYTGQGYEFKPLSF 764 Trichomonas vaginalis G3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap