3J9T


Conserved Protein Domain Family
V_ATPase_I

?
pfam01496: V_ATPase_I 
Click on image for an interactive view with Cn3D
V-type ATPase 116kDa subunit family
This family consists of the 116kDa V-type ATPase (vacuolar (H+)-ATPases) subunits, as well as V-type ATP synthase subunit i. The V-type ATPases family are proton pumps that acidify intracellular compartments in eukaryotic cells for example yeast central vacuoles, clathrin-coated and synaptic vesicles. They have important roles in membrane trafficking processes. The 116kDa subunit (subunit a) in the V-type ATPase is part of the V0 functional domain responsible for proton transport. The a subunit is a transmembrane glycoprotein with multiple putative transmembrane helices it has a hydrophilic amino terminal and a hydrophobic carboxy terminal. It has roles in proton transport and assembly of the V-type ATPase complex. This subunit is encoded by two homologous gene in yeast VPH1 and STV1.
Statistics
?
PSSM-Id: 334565
View PSSM: pfam01496
Aligned: 260 rows
Threshold Bit Score: 646.47
Threshold Setting Gi: 523778760
Created: 17-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3J9T_b         32 TLGQLGLVQFRDLNSkvRAFQRTFVNEIRRLDNVERQYRYFYSLLKKHDIKLYEGDTDkyl------dgsGELYVPPSGS 105
gi 74830321    33 KLGQLAAFQFIDLNSdvSAFQRDFVQEVRRCDGMERKLRYLHDEIEKAGLTCVS-------------------TEAIGRE 93
gi 122045071   33 ciGLLGKAKFVDVNNdvTAFSRHFTTEIRRYDEMERKLSIINGELARERELVEA--------------------CSPSLD 92
gi 1002456187  33 kLGEIGMFQFHDLNKdlSAFQRDFVQEVRRCDDMERKLRFLQEEIDKAGVATIVEGGA------------ESE------- 93
gi 123437726   30 EIAENGKIQLVDNNSgnATMNKRYTEVYLQCEEATRSLSFMKSQLQAAKKLPPQPTL-------------HHALHASHGM 96
gi 523778760   37 DLGNEEIIHFTNLNKkiSNEDLLFNKQIMYVEKYKSRLLFMMDELEKLEIEVGD--------------------QNVKEM 96
gi 67474060    28 RIGKLGIIQFIDLNDnlASFDRRFINEIKRCEEIERIIRIFEETISFEESRDGFNKIFkrnslavdllpiATADAQQSEL 107
gi 67475812    28 LIGELGIVQFIDLNEkeLTFNRRFCNELKRCDELERKIRYFNEMITKEEERKDMNGLKfr---------rNGEFQSFEKE 98
gi 154343025   35 EIGMLGRVQFLDMNQgvTAFARPFTEELRRCEELQRKLHFIEESMRK-DVALLEKY----------------PTDINMSA 97
gi 290973812   54 RLGQLGLVEFKDLSShlNGFQRHYANEVKRCEDLERIIRFFEQEM---EKSNVKFV----------------EESDKMNG 114
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3J9T_b        106 VIDDY------------VRNASYLEERLIQMEDATDQIEVQKNDLEQYRFILQSGDEFFLKGdntdSTSymdedMidang 173
gi 74830321    94 SLFAL------------EHKIDEYEGELRELNGQYQSLLEESNRTQEHLEVLSR--EFGSGIrqspGLNl---------- 149
gi 122045071   93 AHDDVkrilcstmieedEEKVDSLVEELKRVNASLQGLRSEMNFRLELSLLHTRLQDLVSSQfsqpSVAflqtsH----- 167
gi 1002456187  94 TMSSL------------EQKIDEVYSEVMELNEQYQALIEERNRSKEHLEILsrd------------------------- 136
gi 123437726   97 TLQEV------------VNAILQADTELREKSTMYERIKDQLRQLKEKQNLL----EFYIPNldsdDAQdrsevSestrs 160
gi 523778760   97 EIERV------------YMELEKKYNIFMELNEIKKETKANMELLSEIHKILEETEAFLGVNsnaeLETieknnMkn--- 161
gi 67474060   108 SSEQL------------ILKIRTFDNDLKQLTSDVAAAERAVSGIHEAISLSEHINELIGQDidqtTAQtl--------- 166
gi 67475812    99 STENL------------ELKLDSVEKDLKQTISDCTATENDLEKIEEGLLVSSNLDTLFENMddvvVGGl---------- 156
gi 154343025   98 TVEEMqssllrsqmhmiDDRIESTVNDLTAMLTSLEGFQHEMNQNQEMTLLYYKYQLLVETPpvsiASNssfahRgaavt 177
gi 290973812  115 DVNELqegsvn-lldryEREFVKLEAELRNLSDGIEQLVSQKSKAEEFLQVIELAGNLDGEAsees----qsgaSssmln 189
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3J9T_b        174 eNIAAaIGAS----V------NYVTGVIARDKVATLEQILWRVLRGNLFFKTVEIEQpvydvk-treykhKNAFIVFSHG 242
gi 74830321   150 -----------------------LTGVIPKDRIATLERLVYRITRGNSVLHTDEITTpfsege-kermvqKCVFGVYFAT 205
gi 122045071  168 -----------------------LLGMVDAARAEAMYAMAYRATKGNVLIELDNKPAmlldpitgerciaKTPFAIFAPS 224
gi 1002456187 137 ------------fgGatgdglMMVTGVIPKDRIPLFERLVYRATRGNSLMRTDDIDTpfynin-anesvyKSVFAIYFSA 203
gi 123437726  161 lPYNDnMEMQsfnnLp-----S-CTGYVANESIARLQKIILRVTRRNAVIHFGESNSk------------QTPFLVFVSS 222
gi 523778760  162 ------------ikLh----vKFIPGIIDREKAMMLNKVLIGAMRRNVIINSKEVTVng---------keKIFFIIFTHG 216
gi 67474060   167 ---------------------kYLIGTIDTSKWEALRMVIWRVSRGFVVTRSAPIDNr------------KTGFVVFIQG 213
gi 67475812   157 ---------------------kFVIGVIEKSKYDSVQRLIWRVSRGLVLIKSMDLTEgs----------tLRNFLVVYQG 205
gi 154343025  178 sEAFSrLSS--------------LFGIIDTTLSEELYRLCYRITRGNAIVEINNEPAmfvdvqtgkrnvaKTTFVVLCAS 243
gi 290973812  190 rESQMsS-------L------GCLTGVIPSEKVSAFNMLIYRSTRGNAIPKLYEISSpiydsk-lgktvsKLVFTVFFGS 255
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3J9T_b        243 DLIIKRIRKIAESLDANLYD-VDSSNEGRSQQLAKVNKNLSDLYTVLKTTSTTLESELYAIAKELDSWFQDVTREKAIFE 321
gi 74830321   206 PRLWESLKRISEVNGASLYP-YAESTERLQYMRDTLNSQLETMKHTLQQSLLRQRHLLTSISHNVCQWRQTVAVEKSVFS 284
gi 122045071  225 PGLLKRVERLVLTLGATVHS-LR---DVSQAKMEGQHREMEELQEMYDRMHVRKLELIQQHARIYHELLRIVRMKKKVFT 300
gi 1002456187 204 SRLREKLVKIAEANAATVYN-YADSEQQLNSMHASLKQQVDTITQTLHQSAYRQRQVLLGIAASCYEWRRAVVTEKAVFS 282
gi 123437726  223 SVALQKIKAIAQSFSKNVYE-FPTQMEEITRLRNELNGEISQTRSIAIQARSDNLRYLDEVAVHFWDWDARIVRESQIWS 301
gi 523778760  217 ESSLYRAKEICLSLGARIIDpLDKRFNKDEKSLLSISSLISQLEVVQKNNISAIKNEAIAISNKIYTYKYFIEREIKLYK 296
gi 67474060   214 DEVLNKLNQICLTSSARIFDsMPIDVIERINYVNEKRQELNELTEVLNGALEAKRQCLRLIASDINIWNEVIERERQVYF 293
gi 67475812   206 DDLGLKINKICQTSGVRVYTnIPVDQQQRREFVDEALSNKQQLTGIFEGSTKEKRELLKTIALQIEGWKDVIDRERMIFF 285
gi 154343025  244 ATMITRLRKLMSGLGANVYS-LDEVQSRGIEL--TTSTTAHHVEDTVEGVKRRKHDVLTQWYEEHRLYKTYLKVEKVVLT 320
gi 290973812  256 STAKEKIKKICEAMGATIYD-IPSDETPGESSK-KVNQQVRELEMTIENSKSRLLDLLSEIASNMSEWNNNVFREKAIYH 333
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3J9T_b        322 ILNKSnyDTNRKILIAEGWIPRDELATLQARLGEMIARLgIDVPSIIQVLD-Tnh----tP----PTFHRTNKFTAGFQS 392
gi 74830321   285 TMNMLk--fSGSTAVAKGWAPVRSLDRIRASLQEAEYLSgAQVLTIVEEIS-Tke----kR----PTCFFTNKFTVCFQS 353
gi 122045071  301 IMNLCv--vSGSTCTASVWIPKKHEHTLRAAIREAVHASaGEVFSVV-----TlhssqrnP----PTFFDTNKFTQCFQS 369
gi 1002456187 283 TMNMLk--fSGSTAIAQGWAPVRACEDIRTAIAEAEYLSgAQVGTIIEELP-Tke----aP----PSYFKTNKITSSFQG 351
gi 123437726  302 TIDFGdfSRDEGYVYYNGWMPRRYINELGPLAERATHNAnSPVPIRTNNTQaEaqq--reP----PTFIETNNFQYSFQL 375
gi 523778760  297 TMNFLk-iSSGESVVGEAWIRKSQLNELDKIINFIGKSHgRIAYEIVSHRDlT-------P----PTFIKTNAITQSFQD 364
gi 67474060   294 TLNMFyvDEGHSHLCGEGWFPTDQFSEINRALEEIE----GPVKPLFGVIQpH-------PnaipPTYIPTTSFSQCSQD 362
gi 67475812   286 TLNMFk-vDRGTTLRGECWFPSECLDTIVTKLSELDQ---NSMSPIFSPIQaP-------PkaiiPTYNKTNSFTQTFQD 354
gi 154343025  321 TMNMCa--mSGSTCTASAWVPLRHEQALRRALQDAVASAnGSVESIV-----TlhneqqhP----PTFFETTRFTESFQS 389
gi 290973812  334 TLNMFnyDIRNSV-VALGWVAERHVETVRREMEQAMFEMhVEIPTLVDIIH-Tde----tP----PTFFETNKFTEVFQQ 403
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3J9T_b        393 ICDCYGIAQYREINAGLPTIVTFPFMFAIMFGDMGHGFLMTLAALSLVLNEKKINKM-KRG--EIFDMAFTGRYIILLMG 469
gi 74830321   354 IVDSYGMARYKEVNPGVLTIVTFPYLFGIMYGDIGHGVMLTLFAAFLLIKEKDWEGR-KLN--EIFAMIFDGRYLLLLMG 430
gi 122045071  370 IVDSYGAARYKEINPGVFTIVTFPYLFGIMYGDIGHGMLLLLFAFYLILMENRWNRC-QLN--EILAMLFGGRYLLLLMG 446
gi 1002456187 352 IVDSYGMARYKEANPGVFTIISFPYLFGVMYGDVGHGIILTLLAAFLVFKEKSFEGQ-PLN--EIFAMIFGGRYLLLLMG 428
gi 123437726  376 FNDAYGVPNYNEINAGAFYCM-YPFLFGIMFGDMGHSIFYLLVTLGMFIMVPLMKKK-GNSmgGMLEMIDRFKWFLLFAS 453
gi 523778760  365 MTDIFGVPSYKEYNAATFSIFTFPFLYASMFGDVGHGLILTLIGIFLIYRYNAMKGKq-----EILDMLLNGRYMMLFAG 439
gi 67474060   363 LCDSYSIPKYGEVNPGFLYIITFPFLFGVMFGDIGHGIIVFLFALLMIIFQKKIELT-KRN--EIFDMLFGARWMILLMG 439
gi 67475812   355 LTDSYGTPRYGEINTAWLNIVTFPFLFGIMFSDAGHGIFIFGLGLLFIIFQKKLKKA-SLD--DITLMLFDARWLLLEMG 431
gi 154343025  390 IVDSYGMARYKEINPGVFTIITFPYLFGIMYGDIGHGFLLLFIALFFVSKEKAWRTA-QLN--EIVAMVFGGRYLLLLMS 466
gi 290973812  404 IVNSYGIPNYKEMNPAVASVIFFPFLFSVMFGDFGHGLLLSIFSFCMIIFERRLKPIaENN--ELLAMIFQGRYILILMG 481
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3J9T_b        470 VFSMYTGFLYNDIFSKTMTIFKSGWKW--PDHWKKge-siTATSVGT-YP----------------IGLDWAWHGTENAL 529
gi 74830321   431 LFAIYVGFLYNDFFGFSVDTFRSGYQWpplngn---------tqegdmQPsspsgvt---parsviFGIDSAWAETENKL 498
gi 122045071  447 VFSIYMGALYNDFFGFSVGLFSSAYAWppigeqngtvhplgeknrtgiYP----------------MGLDVAWAETENKL 510
gi 1002456187 429 FFAVYMGLLYNDMFGFSIEIFSSAYSWp---QLP------PEGPEGIvYPsfpngrpsvkptspviFGIDSAWSETENKL 499
gi 123437726  454 VCSFYCGFLYNETFCLPINFFGSHYHVddrnsnpqlt--vykknstsiYP----------------FGLDPAWFFKDNEL 515
gi 523778760  440 LYSIYFGFLYSECISTPLSLFPSQYSEsgskyi---------rkggyiYP----------------FGIDPVWHHSKEGS 494
gi 67474060   440 LFSIYCGALYNEFFGIAIDLFGTSWNKenGLFYER-------SNPNYvYP----------------FGVDPIWKSSNNEL 496
gi 67475812   432 LMAIYCGIVFNEFFGFSIDIFGTSWDKveGDVYAR-------SNENYvYY----------------FGVDPIWKSSNNEL 488
gi 154343025  467 LFAIYMGVLYNDFFGFSLNLFSSGYTWapiae-----------qngttYPttpsglpsvkpphvytMGLDAAWAETDNKL 535
gi 290973812  482 LFSIYTGFLYNDGFGLSVDLFPTAFNFdqngigh--------kdesrtYP----------------FGIDPGWFHTSNKL 537
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3J9T_b        530 LFSNSYKMKLSILMGFIHMTYSYFFSLANHLYFNSMIDIIGNFIPGLLFMQGIFGYLSVCIVYKWAVDWVkDG---KP-A 605
gi 74830321   499 EFYNSVKMKCSVIIGVVQMVAGVILSLMNHIYFGDRIQIWFRFVPEIVFLLCTFGYMCVLIIIKWCTNWD-QR---TSeA 574
gi 122045071  511 EFYNSVKMKCAVIVGVVQMLTGNVLSLFNHIYNRELHKAIFLFIPEILFLLCTFGYMSLLIVVKWCTRWE-N----TSeA 585
gi 1002456187 500 EFYNSIKMKCSVIIGVAQMMAGVFISLTNYLYFNDRIKVWFRFVPEIVFLSCTFGYMCLLIIVKWLTTWE-NT---HS-A 574
gi 123437726  516 IFSNSLKMKMSVIVGMAQMIFGLILSFINNFVQRDWVSLITLRVPELLYLVPFYGYMVVIIIWKWCTNFK-------G-N 587
gi 523778760  495 DFSNNLKMKLSVVIGFFHMSLGLVIAFMNSSYKNNKSKMLFQDLPKLLSFYSVIGYMIFLIFFKYVTAI----------D 564
gi 67474060   497 YFYNSLKMKMSILIGVTHMTIGIWISLINHIHYKNLINVVFQFLPEIIFMSCTFGYLCFLILIKWMFFIE-------D-A 568
gi 67475812   489 YYANSLKMKLSILIGVFHMTFGVILSLFNHLHEKKWLNIFFNWIPEMVFMICSFGYLCFLIIFKWCNPDKd------P-A 561
gi 154343025  536 EFYNSVKMKHAVIVGVAQMLAGLLLSLSNSIYEKNWYKVGFLFVPEFLFLLCTFGYMSILIMVKWCCTWE-N----TNkA 610
gi 290973812  538 LFYNSLKMKMAIIFGVGHMTAGLLFSLVNMIQFGHFLDIFLEFIPELLILWCTFGYMSIMIVYKWCVNWG-DEthvNIeI 616
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3J9T_b        606 PG------------LLNMLINMFLSPGTI-DDE--LYPH---------QAKVQVFLLLMALVCIPWLLLVKPLHFKFThk 661
gi 74830321   575 PS------------LLETMTNFFLQPGTV-NVP--LYKG---------QEFVQVLLLLIAFAMVPILLCAIPMHEKKEhe 630
gi 122045071  586 PS------------ILETMTNFFLQPGIV-SQP--LYNG---------QKWVQILLLLTAFAMVPVMLLVMPLIEVRKhr 641
gi 1002456187 575 PS------------LLETMTNFFLAPGTItS-P--LYTG---------QAAVQLVLLLVCALCVPIMLCVIPYMEKREhd 630
gi 123437726  588 PSlynvnvqkdginLIQVMIGMILSFGSE-DDDlkLYEG---------QWGAQAVITTIFFCSIPVFLVLRPCFEAYLhh 657
gi 523778760  565 QS------------IMSIVVSMFTPPFKV-EEP--IYPG---------QIIIQRIIVAVFLISVISFHISQPIYLIIQga 620
gi 67474060   569 PM------------ITNVFLEMFQNFGIV-TEPnhMFWG---------QSFIEPILFIFTVLSVIAMMVPKPILLYVLkk 626
gi 67475812   562 PM------------LTNVFLEMFQNFGRV-TDEnyIFTG---------QKVVEPVLLVLVIISLLLMFIPKPIFLYIKlr 619
gi 154343025  611 PS------------ILEIMTNFFLQPGSV-PNP--LFRG---------QAALQVFLLLLAFVMVPFMLLGMPYIEMRDyk 666
gi 290973812  617 PQ------------LLPTMTDFFLSPWKM-SQPplFYFGgsveeaqkkQTYAQLTLLLIAVISVPILLIPKPVIEYYKqk 683
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3J9T_b        662 kksheplp------------------------------------------------------------------------ 669
gi 74830321   631 rkmrl--------------------------------------------------------------------------- 635
gi 122045071  642 eeylgyrlfldsvslpaingsdsktsedpivtvs---------------------------------tarrnefpvasle 688
gi 1002456187 631 hkvqeraahppa-------------------------------------------------------------------- 642
gi 123437726      --------------------------------------------------------------------------------
gi 523778760      --------------------------------------------------------------------------------
gi 67474060   627 kdqkrsengqgqdnyyqpfnqenndfitedirqenndipylpnendgyivannnieemqeqfenedrvsllgnenksikk 706
gi 67475812   620 kqqrthpesrplleqvdtnd------------------------------------------------------------ 639
gi 154343025  667 rwkqrrhvgggrhyggsqrasmitienadfsdvffneppvsrq---------------hrsycdsgderahrslmsdddt 731
gi 290973812  684 rklkkvl------------------------------------------------------------------------- 690
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3J9T_b        670 -------------steadassedLEAQQLISAMDAdDaEEEEVgsgshGEDFGDIMIHQVIHTIEFCLNCVSHTASYLRL 736
gi 74830321   636 -------------------qalarrnEDERHEGSEdD-YDEDE-----KFDFSEVVIHQVIHTIEYVLGCVSNTASYLRL 690
gi 122045071  689 ntlgshlgmgwennhtedtplghASYGTGAAPADYdD-YEGGN-----RLDSSEVFIHYVIHTIEYVLGCVSNTASYLRL 762
gi 1002456187 643 ----------------------------------------egeeeedddfefseIVIHQIIHTIEYVLGCVSNTASYLRL 682
gi 123437726  658 ----------------------------------------gDP-----NWSVLEAIVMNLIHVIEFVLQALSHTASYLRL 692
gi 523778760  621 -------------------------------------------------kDSLDLFLHYVIEGIEFAIGLISHISSYLRI 651
gi 67474060   707 enllseeskiskilklikkknpnYTFDEKEWIRVKyD-PDDEN-----GNNLLEIIIFNTIHAVEFILGCISNTASYLRL 780
gi 67475812   640 --gefgdfsdnqyssdnntllnnNEGINENNTKQEeE-EDNEE-----GNSLMEIIIFNSIHAIEYVLGCISNTASYLRL 711
gi 154343025  732 aappaaniffdddsmhpfggapsDSEGGATAQVIQnE-NEKFE-----NFDVSELIIHYAIHTIEYVLSSVSNTASYLRL 805
gi 290973812  691 --------------esepvlsnsEEESHEIKLDETkV-TNHAE-----IEPFSELFIKQLIHTIEYVLNTVSNTASYLRL 750
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3J9T_b        737 WALSLAHAQLSSVLWTMTIQiA-F----------Gfrgf----------vgvFMTVALFA-MWFALTCAVLVLMEGTSAM 794
gi 74830321   691 WALSLAHSQLSEVFWSFTFLmA-Ldm------dkGs---------------gVFVFFGLC-VWMCATVAVLLGMESLSAF 747
gi 122045071  763 WALSLAHAQLSEVFFNFAVVkV-Lgm-------dTt---------------gVFIAAGIA-IWLAVTLAVLVGMEALSAF 818
gi 1002456187 683 WALSLAHSQLSEVFWSFAFLlTvGl---------Dgg-------------sgFFVFIGFA-VWMAATIGVLLGMESLSAF 739
gi 123437726  693 WALSLAHSQLSKVIWEELF----L----------NgfnyskthdgpwtngtwVLTFFVFL-AFTVMTAAILLGMEAFSAL 757
gi 523778760  652 WAVSLAHYQLGNILFSYLIDv-------------S-----------------WMYYIVTVpLWALFTFFLIMALEGVSTA 701
gi 67474060   781 WALSLAHAQLGSVFLEYVFYtL-Lef------nnF-----------------FLTFVGFA-LFALITLGILIGMESLSAF 835
gi 67475812   712 WALSLAHAQLGSVFLENVFYlL-Mem------niF-----------------ITIFVGFA-VWALITLAILIGMESLSAF 766
gi 154343025  806 WALSLAHAQLSEVFFNFAVVqT-Lnv------dnSs---------------gLVIAIGVL-LWLGATLGVLVGMEALSAF 862
gi 290973812  751 WALSLAHAQLSEVFWQMTLGiL-LnslesyplleDilv-----------hygIGVFFLCA-LWFGMTIGVLLIMESLSAF 817
                         970       980
                  ....*....|....*....|....*...
3J9T_b        795 LHSLRLHWVESMSKFFVGEGLPYEPFAF 822
gi 74830321   748 LHALRLHWVEFNNKFYAADGYPFTPFNi 775
gi 122045071  819 LHALRLHWVEFNNKFYVGDGVAHEPFDl 846
gi 1002456187 740 LHALRLHWVEFNNKFYLADGYAFEPFdl 767
gi 123437726  758 LHGIRLMWVEFCSKFYGGGGYEFKPVSl 785
gi 523778760  702 LHAMRLNWIEFNSKFYEGEGYSFRPLQF 729
gi 67474060   836 LHTLRLHWVEFQNKFYLGDGIKFVPFKl 863
gi 67475812   767 LHTLRLHWIEFQNKFYIGDGIPFIPLrl 794
gi 154343025  863 LHALRLHWVEFQSKFYAGDGRAFDPmdl 890
gi 290973812  818 LHAIRLTWIEFQGKFFGGTGSLFQPFSF 845
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap