3J9T


Conserved Protein Domain Family
V_ATPase_I

?
pfam01496: V_ATPase_I 
Click on image for an interactive view with Cn3D
V-type ATPase 116kDa subunit family
This family consists of the 116kDa V-type ATPase (vacuolar (H+)-ATPases) subunits, as well as V-type ATP synthase subunit i. The V-type ATPases family are proton pumps that acidify intracellular compartments in eukaryotic cells for example yeast central vacuoles, clathrin-coated and synaptic vesicles. They have important roles in membrane trafficking processes. The 116kDa subunit (subunit a) in the V-type ATPase is part of the V0 functional domain responsible for proton transport. The a subunit is a transmembrane glycoprotein with multiple putative transmembrane helices it has a hydrophilic amino terminal and a hydrophobic carboxy terminal. It has roles in proton transport and assembly of the V-type ATPase complex. This subunit is encoded by two homologous gene in yeast VPH1 and STV1.
Statistics
?
PSSM-Id: 334565
View PSSM: pfam01496
Aligned: 260 rows
Threshold Bit Score: 646.47
Threshold Setting Gi: 523778760
Created: 17-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3J9T_BB       32 TLGQLGLVQFRDLNSkvRAFQRTFVNEIRRLDNVERQYRYFYSLLKKHDIKLYEGDTDkyl------dgsGELYVPPSGS 105 baker's yeast
Q57VD3        33 KLGQLAAFQFIDLNSdvSAFQRDFVQEVRRCDGMERKLRYLHDEIEKAGLTCVS-------------------TEAIGRE 93  Trypanosoma brucei
Q4DY50        33 ciGLLGKAKFVDVNNdvTAFSRHFTTEIRRYDEMERKLSIINGELARERELVEA--------------------CSPSLD 92  Trypanosoma cruzi
XP_015662232  33 kLGEIGMFQFHDLNKdlSAFQRDFVQEVRRCDDMERKLRFLQEEIDKAGVATIVEGGA------------ESE------- 93  Leptomonas pyrr...
XP_001309656  30 EIAENGKIQLVDNNSgnATMNKRYTEVYLQCEEATRSLSFMKSQLQAAKKLPPQPTL-------------HHALHASHGM 96  Trichomonas vag...
EPR78787      37 DLGNEEIIHFTNLNKkiSNEDLLFNKQIMYVEKYKSRLLFMMDELEKLEIEVGD--------------------QNVKEM 96  Spraguea lophii...
XP_652779     28 RIGKLGIIQFIDLNDnlASFDRRFINEIKRCEEIERIIRIFEETISFEESRDGFNKIFkrnslavdllpiATADAQQSEL 107 Entamoeba histo...
XP_653563     28 LIGELGIVQFIDLNEkeLTFNRRFCNELKRCDELERKIRYFNEMITKEEERKDMNGLKfr---------rNGEFQSFEKE 98  Entamoeba histo...
XP_001567458  35 EIGMLGRVQFLDMNQgvTAFARPFTEELRRCEELQRKLHFIEESMRK-DVALLEKY----------------PTDINMSA 97  Leishmania braz...
XP_002669641  54 RLGQLGLVEFKDLSShlNGFQRHYANEVKRCEDLERIIRFFEQEM---EKSNVKFV----------------EESDKMNG 114 Naegleria grube...
3J9T_BB      106 VIDDY------------VRNASYLEERLIQMEDATDQIEVQKNDLEQYRFILQSGDEFFLKGdntdSTSymdedMidang 173 baker's yeast
Q57VD3        94 SLFAL------------EHKIDEYEGELRELNGQYQSLLEESNRTQEHLEVLSR--EFGSGIrqspGLNl---------- 149 Trypanosoma brucei
Q4DY50        93 AHDDVkrilcstmieedEEKVDSLVEELKRVNASLQGLRSEMNFRLELSLLHTRLQDLVSSQfsqpSVAflqtsH----- 167 Trypanosoma cruzi
XP_015662232  94 TMSSL------------EQKIDEVYSEVMELNEQYQALIEERNRSKEHLEILsrd------------------------- 136 Leptomonas pyrr...
XP_001309656  97 TLQEV------------VNAILQADTELREKSTMYERIKDQLRQLKEKQNLL----EFYIPNldsdDAQdrsevSestrs 160 Trichomonas vag...
EPR78787      97 EIERV------------YMELEKKYNIFMELNEIKKETKANMELLSEIHKILEETEAFLGVNsnaeLETieknnMkn--- 161 Spraguea lophii...
XP_652779    108 SSEQL------------ILKIRTFDNDLKQLTSDVAAAERAVSGIHEAISLSEHINELIGQDidqtTAQtl--------- 166 Entamoeba histo...
XP_653563     99 STENL------------ELKLDSVEKDLKQTISDCTATENDLEKIEEGLLVSSNLDTLFENMddvvVGGl---------- 156 Entamoeba histo...
XP_001567458  98 TVEEMqssllrsqmhmiDDRIESTVNDLTAMLTSLEGFQHEMNQNQEMTLLYYKYQLLVETPpvsiASNssfahRgaavt 177 Leishmania braz...
XP_002669641 115 DVNELqegsvn-lldryEREFVKLEAELRNLSDGIEQLVSQKSKAEEFLQVIELAGNLDGEAsees----qsgaSssmln 189 Naegleria grube...
3J9T_BB      174 eNIAAaIGAS----V------NYVTGVIARDKVATLEQILWRVLRGNLFFKTVEIEQpvydvk-treykhKNAFIVFSHG 242 baker's yeast
Q57VD3       150 -----------------------LTGVIPKDRIATLERLVYRITRGNSVLHTDEITTpfsege-kermvqKCVFGVYFAT 205 Trypanosoma brucei
Q4DY50       168 -----------------------LLGMVDAARAEAMYAMAYRATKGNVLIELDNKPAmlldpitgerciaKTPFAIFAPS 224 Trypanosoma cruzi
XP_015662232 137 ------------fgGatgdglMMVTGVIPKDRIPLFERLVYRATRGNSLMRTDDIDTpfynin-anesvyKSVFAIYFSA 203 Leptomonas pyrr...
XP_001309656 161 lPYNDnMEMQsfnnLp-----S-CTGYVANESIARLQKIILRVTRRNAVIHFGESNSk------------QTPFLVFVSS 222 Trichomonas vag...
EPR78787     162 ------------ikLh----vKFIPGIIDREKAMMLNKVLIGAMRRNVIINSKEVTVng---------keKIFFIIFTHG 216 Spraguea lophii...
XP_652779    167 ---------------------kYLIGTIDTSKWEALRMVIWRVSRGFVVTRSAPIDNr------------KTGFVVFIQG 213 Entamoeba histo...
XP_653563    157 ---------------------kFVIGVIEKSKYDSVQRLIWRVSRGLVLIKSMDLTEgs----------tLRNFLVVYQG 205 Entamoeba histo...
XP_001567458 178 sEAFSrLSS--------------LFGIIDTTLSEELYRLCYRITRGNAIVEINNEPAmfvdvqtgkrnvaKTTFVVLCAS 243 Leishmania braz...
XP_002669641 190 rESQMsS-------L------GCLTGVIPSEKVSAFNMLIYRSTRGNAIPKLYEISSpiydsk-lgktvsKLVFTVFFGS 255 Naegleria grube...
3J9T_BB      243 DLIIKRIRKIAESLDANLYD-VDSSNEGRSQQLAKVNKNLSDLYTVLKTTSTTLESELYAIAKELDSWFQDVTREKAIFE 321 baker's yeast
Q57VD3       206 PRLWESLKRISEVNGASLYP-YAESTERLQYMRDTLNSQLETMKHTLQQSLLRQRHLLTSISHNVCQWRQTVAVEKSVFS 284 Trypanosoma brucei
Q4DY50       225 PGLLKRVERLVLTLGATVHS-LR---DVSQAKMEGQHREMEELQEMYDRMHVRKLELIQQHARIYHELLRIVRMKKKVFT 300 Trypanosoma cruzi
XP_015662232 204 SRLREKLVKIAEANAATVYN-YADSEQQLNSMHASLKQQVDTITQTLHQSAYRQRQVLLGIAASCYEWRRAVVTEKAVFS 282 Leptomonas pyrr...
XP_001309656 223 SVALQKIKAIAQSFSKNVYE-FPTQMEEITRLRNELNGEISQTRSIAIQARSDNLRYLDEVAVHFWDWDARIVRESQIWS 301 Trichomonas vag...
EPR78787     217 ESSLYRAKEICLSLGARIIDpLDKRFNKDEKSLLSISSLISQLEVVQKNNISAIKNEAIAISNKIYTYKYFIEREIKLYK 296 Spraguea lophii...
XP_652779    214 DEVLNKLNQICLTSSARIFDsMPIDVIERINYVNEKRQELNELTEVLNGALEAKRQCLRLIASDINIWNEVIERERQVYF 293 Entamoeba histo...
XP_653563    206 DDLGLKINKICQTSGVRVYTnIPVDQQQRREFVDEALSNKQQLTGIFEGSTKEKRELLKTIALQIEGWKDVIDRERMIFF 285 Entamoeba histo...
XP_001567458 244 ATMITRLRKLMSGLGANVYS-LDEVQSRGIEL--TTSTTAHHVEDTVEGVKRRKHDVLTQWYEEHRLYKTYLKVEKVVLT 320 Leishmania braz...
XP_002669641 256 STAKEKIKKICEAMGATIYD-IPSDETPGESSK-KVNQQVRELEMTIENSKSRLLDLLSEIASNMSEWNNNVFREKAIYH 333 Naegleria grube...
3J9T_BB      322 ILNKSnyDTNRKILIAEGWIPRDELATLQARLGEMIARLgIDVPSIIQVLD-Tnh----tP----PTFHRTNKFTAGFQS 392 baker's yeast
Q57VD3       285 TMNMLk--fSGSTAVAKGWAPVRSLDRIRASLQEAEYLSgAQVLTIVEEIS-Tke----kR----PTCFFTNKFTVCFQS 353 Trypanosoma brucei
Q4DY50       301 IMNLCv--vSGSTCTASVWIPKKHEHTLRAAIREAVHASaGEVFSVV-----TlhssqrnP----PTFFDTNKFTQCFQS 369 Trypanosoma cruzi
XP_015662232 283 TMNMLk--fSGSTAIAQGWAPVRACEDIRTAIAEAEYLSgAQVGTIIEELP-Tke----aP----PSYFKTNKITSSFQG 351 Leptomonas pyrr...
XP_001309656 302 TIDFGdfSRDEGYVYYNGWMPRRYINELGPLAERATHNAnSPVPIRTNNTQaEaqq--reP----PTFIETNNFQYSFQL 375 Trichomonas vag...
EPR78787     297 TMNFLk-iSSGESVVGEAWIRKSQLNELDKIINFIGKSHgRIAYEIVSHRDlT-------P----PTFIKTNAITQSFQD 364 Spraguea lophii...
XP_652779    294 TLNMFyvDEGHSHLCGEGWFPTDQFSEINRALEEIE----GPVKPLFGVIQpH-------PnaipPTYIPTTSFSQCSQD 362 Entamoeba histo...
XP_653563    286 TLNMFk-vDRGTTLRGECWFPSECLDTIVTKLSELDQ---NSMSPIFSPIQaP-------PkaiiPTYNKTNSFTQTFQD 354 Entamoeba histo...
XP_001567458 321 TMNMCa--mSGSTCTASAWVPLRHEQALRRALQDAVASAnGSVESIV-----TlhneqqhP----PTFFETTRFTESFQS 389 Leishmania braz...
XP_002669641 334 TLNMFnyDIRNSV-VALGWVAERHVETVRREMEQAMFEMhVEIPTLVDIIH-Tde----tP----PTFFETNKFTEVFQQ 403 Naegleria grube...
3J9T_BB      393 ICDCYGIAQYREINAGLPTIVTFPFMFAIMFGDMGHGFLMTLAALSLVLNEKKINKM-KRG--EIFDMAFTGRYIILLMG 469 baker's yeast
Q57VD3       354 IVDSYGMARYKEVNPGVLTIVTFPYLFGIMYGDIGHGVMLTLFAAFLLIKEKDWEGR-KLN--EIFAMIFDGRYLLLLMG 430 Trypanosoma brucei
Q4DY50       370 IVDSYGAARYKEINPGVFTIVTFPYLFGIMYGDIGHGMLLLLFAFYLILMENRWNRC-QLN--EILAMLFGGRYLLLLMG 446 Trypanosoma cruzi
XP_015662232 352 IVDSYGMARYKEANPGVFTIISFPYLFGVMYGDVGHGIILTLLAAFLVFKEKSFEGQ-PLN--EIFAMIFGGRYLLLLMG 428 Leptomonas pyrr...
XP_001309656 376 FNDAYGVPNYNEINAGAFYCM-YPFLFGIMFGDMGHSIFYLLVTLGMFIMVPLMKKK-GNSmgGMLEMIDRFKWFLLFAS 453 Trichomonas vag...
EPR78787     365 MTDIFGVPSYKEYNAATFSIFTFPFLYASMFGDVGHGLILTLIGIFLIYRYNAMKGKq-----EILDMLLNGRYMMLFAG 439 Spraguea lophii...
XP_652779    363 LCDSYSIPKYGEVNPGFLYIITFPFLFGVMFGDIGHGIIVFLFALLMIIFQKKIELT-KRN--EIFDMLFGARWMILLMG 439 Entamoeba histo...
XP_653563    355 LTDSYGTPRYGEINTAWLNIVTFPFLFGIMFSDAGHGIFIFGLGLLFIIFQKKLKKA-SLD--DITLMLFDARWLLLEMG 431 Entamoeba histo...
XP_001567458 390 IVDSYGMARYKEINPGVFTIITFPYLFGIMYGDIGHGFLLLFIALFFVSKEKAWRTA-QLN--EIVAMVFGGRYLLLLMS 466 Leishmania braz...
XP_002669641 404 IVNSYGIPNYKEMNPAVASVIFFPFLFSVMFGDFGHGLLLSIFSFCMIIFERRLKPIaENN--ELLAMIFQGRYILILMG 481 Naegleria grube...
3J9T_BB      470 VFSMYTGFLYNDIFSKTMTIFKSGWKW--PDHWKKge-siTATSVGT-YP----------------IGLDWAWHGTENAL 529 baker's yeast
Q57VD3       431 LFAIYVGFLYNDFFGFSVDTFRSGYQWpplngn---------tqegdmQPsspsgvt---parsviFGIDSAWAETENKL 498 Trypanosoma brucei
Q4DY50       447 VFSIYMGALYNDFFGFSVGLFSSAYAWppigeqngtvhplgeknrtgiYP----------------MGLDVAWAETENKL 510 Trypanosoma cruzi
XP_015662232 429 FFAVYMGLLYNDMFGFSIEIFSSAYSWp---QLP------PEGPEGIvYPsfpngrpsvkptspviFGIDSAWSETENKL 499 Leptomonas pyrr...
XP_001309656 454 VCSFYCGFLYNETFCLPINFFGSHYHVddrnsnpqlt--vykknstsiYP----------------FGLDPAWFFKDNEL 515 Trichomonas vag...
EPR78787     440 LYSIYFGFLYSECISTPLSLFPSQYSEsgskyi---------rkggyiYP----------------FGIDPVWHHSKEGS 494 Spraguea lophii...
XP_652779    440 LFSIYCGALYNEFFGIAIDLFGTSWNKenGLFYER-------SNPNYvYP----------------FGVDPIWKSSNNEL 496 Entamoeba histo...
XP_653563    432 LMAIYCGIVFNEFFGFSIDIFGTSWDKveGDVYAR-------SNENYvYY----------------FGVDPIWKSSNNEL 488 Entamoeba histo...
XP_001567458 467 LFAIYMGVLYNDFFGFSLNLFSSGYTWapiae-----------qngttYPttpsglpsvkpphvytMGLDAAWAETDNKL 535 Leishmania braz...
XP_002669641 482 LFSIYTGFLYNDGFGLSVDLFPTAFNFdqngigh--------kdesrtYP----------------FGIDPGWFHTSNKL 537 Naegleria grube...
3J9T_BB      530 LFSNSYKMKLSILMGFIHMTYSYFFSLANHLYFNSMIDIIGNFIPGLLFMQGIFGYLSVCIVYKWAVDWVkDG---KP-A 605 baker's yeast
Q57VD3       499 EFYNSVKMKCSVIIGVVQMVAGVILSLMNHIYFGDRIQIWFRFVPEIVFLLCTFGYMCVLIIIKWCTNWD-QR---TSeA 574 Trypanosoma brucei
Q4DY50       511 EFYNSVKMKCAVIVGVVQMLTGNVLSLFNHIYNRELHKAIFLFIPEILFLLCTFGYMSLLIVVKWCTRWE-N----TSeA 585 Trypanosoma cruzi
XP_015662232 500 EFYNSIKMKCSVIIGVAQMMAGVFISLTNYLYFNDRIKVWFRFVPEIVFLSCTFGYMCLLIIVKWLTTWE-NT---HS-A 574 Leptomonas pyrr...
XP_001309656 516 IFSNSLKMKMSVIVGMAQMIFGLILSFINNFVQRDWVSLITLRVPELLYLVPFYGYMVVIIIWKWCTNFK-------G-N 587 Trichomonas vag...
EPR78787     495 DFSNNLKMKLSVVIGFFHMSLGLVIAFMNSSYKNNKSKMLFQDLPKLLSFYSVIGYMIFLIFFKYVTAI----------D 564 Spraguea lophii...
XP_652779    497 YFYNSLKMKMSILIGVTHMTIGIWISLINHIHYKNLINVVFQFLPEIIFMSCTFGYLCFLILIKWMFFIE-------D-A 568 Entamoeba histo...
XP_653563    489 YYANSLKMKLSILIGVFHMTFGVILSLFNHLHEKKWLNIFFNWIPEMVFMICSFGYLCFLIIFKWCNPDKd------P-A 561 Entamoeba histo...
XP_001567458 536 EFYNSVKMKHAVIVGVAQMLAGLLLSLSNSIYEKNWYKVGFLFVPEFLFLLCTFGYMSILIMVKWCCTWE-N----TNkA 610 Leishmania braz...
XP_002669641 538 LFYNSLKMKMAIIFGVGHMTAGLLFSLVNMIQFGHFLDIFLEFIPELLILWCTFGYMSIMIVYKWCVNWG-DEthvNIeI 616 Naegleria grube...
3J9T_BB      606 PG------------LLNMLINMFLSPGTI-DDE--LYPH---------QAKVQVFLLLMALVCIPWLLLVKPLHFKFThk 661 baker's yeast
Q57VD3       575 PS------------LLETMTNFFLQPGTV-NVP--LYKG---------QEFVQVLLLLIAFAMVPILLCAIPMHEKKEhe 630 Trypanosoma brucei
Q4DY50       586 PS------------ILETMTNFFLQPGIV-SQP--LYNG---------QKWVQILLLLTAFAMVPVMLLVMPLIEVRKhr 641 Trypanosoma cruzi
XP_015662232 575 PS------------LLETMTNFFLAPGTItS-P--LYTG---------QAAVQLVLLLVCALCVPIMLCVIPYMEKREhd 630 Leptomonas pyrr...
XP_001309656 588 PSlynvnvqkdginLIQVMIGMILSFGSE-DDDlkLYEG---------QWGAQAVITTIFFCSIPVFLVLRPCFEAYLhh 657 Trichomonas vag...
EPR78787     565 QS------------IMSIVVSMFTPPFKV-EEP--IYPG---------QIIIQRIIVAVFLISVISFHISQPIYLIIQga 620 Spraguea lophii...
XP_652779    569 PM------------ITNVFLEMFQNFGIV-TEPnhMFWG---------QSFIEPILFIFTVLSVIAMMVPKPILLYVLkk 626 Entamoeba histo...
XP_653563    562 PM------------LTNVFLEMFQNFGRV-TDEnyIFTG---------QKVVEPVLLVLVIISLLLMFIPKPIFLYIKlr 619 Entamoeba histo...
XP_001567458 611 PS------------ILEIMTNFFLQPGSV-PNP--LFRG---------QAALQVFLLLLAFVMVPFMLLGMPYIEMRDyk 666 Leishmania braz...
XP_002669641 617 PQ------------LLPTMTDFFLSPWKM-SQPplFYFGgsveeaqkkQTYAQLTLLLIAVISVPILLIPKPVIEYYKqk 683 Naegleria grube...
3J9T_BB      662 kksheplp------------------------------------------------------------------------ 669 baker's yeast
Q57VD3       631 rkmrl--------------------------------------------------------------------------- 635 Trypanosoma brucei
Q4DY50       642 eeylgyrlfldsvslpaingsdsktsedpivtvs---------------------------------tarrnefpvasle 688 Trypanosoma cruzi
XP_015662232 631 hkvqeraahppa-------------------------------------------------------------------- 642 Leptomonas pyrr...
XP_001309656     -------------------------------------------------------------------------------- Trichomonas vag...
EPR78787         -------------------------------------------------------------------------------- Spraguea lophii...
XP_652779    627 kdqkrsengqgqdnyyqpfnqenndfitedirqenndipylpnendgyivannnieemqeqfenedrvsllgnenksikk 706 Entamoeba histo...
XP_653563    620 kqqrthpesrplleqvdtnd------------------------------------------------------------ 639 Entamoeba histo...
XP_001567458 667 rwkqrrhvgggrhyggsqrasmitienadfsdvffneppvsrq---------------hrsycdsgderahrslmsdddt 731 Leishmania braz...
XP_002669641 684 rklkkvl------------------------------------------------------------------------- 690 Naegleria grube...
3J9T_BB      670 -------------steadassedLEAQQLISAMDAdDaEEEEVgsgshGEDFGDIMIHQVIHTIEFCLNCVSHTASYLRL 736 baker's yeast
Q57VD3       636 -------------------qalarrnEDERHEGSEdD-YDEDE-----KFDFSEVVIHQVIHTIEYVLGCVSNTASYLRL 690 Trypanosoma brucei
Q4DY50       689 ntlgshlgmgwennhtedtplghASYGTGAAPADYdD-YEGGN-----RLDSSEVFIHYVIHTIEYVLGCVSNTASYLRL 762 Trypanosoma cruzi
XP_015662232 643 ----------------------------------------egeeeedddfefseIVIHQIIHTIEYVLGCVSNTASYLRL 682 Leptomonas pyrr...
XP_001309656 658 ----------------------------------------gDP-----NWSVLEAIVMNLIHVIEFVLQALSHTASYLRL 692 Trichomonas vag...
EPR78787     621 -------------------------------------------------kDSLDLFLHYVIEGIEFAIGLISHISSYLRI 651 Spraguea lophii...
XP_652779    707 enllseeskiskilklikkknpnYTFDEKEWIRVKyD-PDDEN-----GNNLLEIIIFNTIHAVEFILGCISNTASYLRL 780 Entamoeba histo...
XP_653563    640 --gefgdfsdnqyssdnntllnnNEGINENNTKQEeE-EDNEE-----GNSLMEIIIFNSIHAIEYVLGCISNTASYLRL 711 Entamoeba histo...
XP_001567458 732 aappaaniffdddsmhpfggapsDSEGGATAQVIQnE-NEKFE-----NFDVSELIIHYAIHTIEYVLSSVSNTASYLRL 805 Leishmania braz...
XP_002669641 691 --------------esepvlsnsEEESHEIKLDETkV-TNHAE-----IEPFSELFIKQLIHTIEYVLNTVSNTASYLRL 750 Naegleria grube...
3J9T_BB      737 WALSLAHAQLSSVLWTMTIQiA-F----------Gfrgf----------vgvFMTVALFA-MWFALTCAVLVLMEGTSAM 794 baker's yeast
Q57VD3       691 WALSLAHSQLSEVFWSFTFLmA-Ldm------dkGs---------------gVFVFFGLC-VWMCATVAVLLGMESLSAF 747 Trypanosoma brucei
Q4DY50       763 WALSLAHAQLSEVFFNFAVVkV-Lgm-------dTt---------------gVFIAAGIA-IWLAVTLAVLVGMEALSAF 818 Trypanosoma cruzi
XP_015662232 683 WALSLAHSQLSEVFWSFAFLlTvGl---------Dgg-------------sgFFVFIGFA-VWMAATIGVLLGMESLSAF 739 Leptomonas pyrr...
XP_001309656 693 WALSLAHSQLSKVIWEELF----L----------NgfnyskthdgpwtngtwVLTFFVFL-AFTVMTAAILLGMEAFSAL 757 Trichomonas vag...
EPR78787     652 WAVSLAHYQLGNILFSYLIDv-------------S-----------------WMYYIVTVpLWALFTFFLIMALEGVSTA 701 Spraguea lophii...
XP_652779    781 WALSLAHAQLGSVFLEYVFYtL-Lef------nnF-----------------FLTFVGFA-LFALITLGILIGMESLSAF 835 Entamoeba histo...
XP_653563    712 WALSLAHAQLGSVFLENVFYlL-Mem------niF-----------------ITIFVGFA-VWALITLAILIGMESLSAF 766 Entamoeba histo...
XP_001567458 806 WALSLAHAQLSEVFFNFAVVqT-Lnv------dnSs---------------gLVIAIGVL-LWLGATLGVLVGMEALSAF 862 Leishmania braz...
XP_002669641 751 WALSLAHAQLSEVFWQMTLGiL-LnslesyplleDilv-----------hygIGVFFLCA-LWFGMTIGVLLIMESLSAF 817 Naegleria grube...
3J9T_BB      795 LHSLRLHWVESMSKFFVGEGLPYEPFAF 822 baker's yeast
Q57VD3       748 LHALRLHWVEFNNKFYAADGYPFTPFNi 775 Trypanosoma brucei
Q4DY50       819 LHALRLHWVEFNNKFYVGDGVAHEPFDl 846 Trypanosoma cruzi
XP_015662232 740 LHALRLHWVEFNNKFYLADGYAFEPFdl 767 Leptomonas pyrrhocoris
XP_001309656 758 LHGIRLMWVEFCSKFYGGGGYEFKPVSl 785 Trichomonas vaginalis G3
EPR78787     702 LHAMRLNWIEFNSKFYEGEGYSFRPLQF 729 Spraguea lophii 42_110
XP_652779    836 LHTLRLHWVEFQNKFYLGDGIKFVPFKl 863 Entamoeba histolytica HM-1:IMSS
XP_653563    767 LHTLRLHWIEFQNKFYIGDGIPFIPLrl 794 Entamoeba histolytica HM-1:IMSS
XP_001567458 863 LHALRLHWVEFQSKFYAGDGRAFDPmdl 890 Leishmania braziliensis MHOM/BR/75/M2904
XP_002669641 818 LHAIRLTWIEFQGKFFGGTGSLFQPFSF 845 Naegleria gruberi strain NEG-M
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap