1DOC,1FOH,4CY8


Conserved Protein Domain Family
FAD_binding_3

?
pfam01494: FAD_binding_3 
Click on image for an interactive view with Cn3D
FAD binding domain
This domain is involved in FAD binding in a number of enzymes.
Statistics
?
Aligned: 19 rows
Threshold Bit Score: 321.582
Threshold Setting Gi: 81343258
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1DOC_A   2 KTQVA-IIGAGPSGLLLGQLLHKAGID------NVILERQTPDYVLGriRAGVLEQGMVDLLREAGVDRRMARDGlVHEG 74  Pseudomonas aeruginosa
O05144   6 DTEVL-IVGAGPAGLMLANILGMYGKQ------VTVLEAMDTLIDYP--RGVGLDDESFRTIQTVGLVDAIRPHTnPQHI 76  Rhodococcus globerulus
P42535  14 DAAVL-IVGGGPTGLIAANELLRRGVS------CRMIDRLPVAHQTS--KSCTIHARSMEMMEHIGIAARYIETGvRSNG 84  Sphingobium chlorophe...
P95598   1 mSDVI-IVGAGPTGLMLAGELRLQGVD------VVVVDKDEEPTQFV--RALGIHVRSIEIMEQRGLLDKFLAHGrKYPL 71  Rhodococcus hoagii
O07561   4 KYEAV-IIGGGPVGFMLASELAIAGVG------TCVIERLEKPVPHS--KALTLHPRTLELLEMRGILERFVSKGsKIPT 74  Bacillus subtilis sub...
Q54171   2 DASVI-VAGAGPTGLMLAGELRLAGVD------VIVLDRLAERTGES--RGLGFTTRTMEVFDQRGLLHRLGDMGtSNA- 71  Streptomyces fradiae
O65936  51 ETTTCaIIGGGPAGMVLGLLLARAGVQ------VTLLEKHGDFLRDF--RGDTVHPTTMRLLDELGLWERFAALPySEVR 122 Mycobacterium tubercu...
Q59744   2 RTQVA-IIGSGPSGLLLGQLLTEAGID------NVILDRVNKDYILGrvRAGVLEEGTVGLLDQARSGARLHAEGlPHDG 74  Rhizobium leguminosarum
Q03298   5 KTKVA-IIGSGPAGLLLGQLLYKAGIE------HVIVEQRSADYVASriRAGILEQVSVDLLEQAGVDQNLKEKGlPHSG 77  Acinetobacter baylyi ...
1FOH_D   7 YCDVL-IVGAGPAGLMAARVLSEY-VRqkpdlkVRIIDKRSTKVYNG--QADGLQCRTLESLKNLGLADKILSEA--NDM 80  Cutaneotrichosporon c...
1DOC_A  75 VEIAFAGQ-----------------------------------------------------RRRIDLKr---L-SGGKTV 97  Pseudomonas aeruginosa
O05144  77 MRLVNGAG-----------------------------------------------------KVMLVNNpqtvE-FGWERK 102 Rhodococcus globerulus
P42535  85 FTFNFENT-----------------------------------------------------DANALLDfsvlP-GRYPFI 110 Sphingobium chlorophe...
P95598  72 GGFFAGISk----------------------------------------------------PAPAHLD------TAHGYV 93  Rhodococcus hoagii
O07561  75 -GHFSMLD--------------------------------------------------------TRLDfsglD-TSCPYT 96  Bacillus subtilis sub...
Q54171  72 -GHFGGLP----------------------------------------------------------VDfgvlD-SVHQAA 91  Streptomyces fradiae
O65936 123 TATLHSNG-----------------------------------------------------RAVTYIDferlH-QPYPYV 148 Mycobacterium tubercu...
Q59744  75 FSLAFDGR-----------------------------------------------------DHRIDLHe---L-TGGRRV 97  Rhizobium leguminosarum
Q03298  78 IEILTNGQ-----------------------------------------------------KFRVDLSa---L-TQGKQV 100 Acinetobacter baylyi ...
1FOH_D  81 STIALYNPdenghirrtdripdtlpgisryhqvvlhqgrierhildsiaeisdtrikverpLIPEKMEi---DsSKAEDP 157 Cutaneotrichosporon c...
1DOC_A  98 TVYGQTEVTRDLMEAREACGaTTVYQAAE---VR--LHDLQGERPYVT---FERDGER---LRLDCDYIAGCDGFHGISR 166 Pseudomonas aeruginosa
O05144 103 HGFIQPEADKALYEGLSRFGnVQVLFGHR---VEnvEEDGQSVTAIAL---VSRPDGTieeRRFSAQYLVGCEGGKSPTR 176 Rhodococcus globerulus
P42535 111 TIYNQNETERVLRHDLEATYsFQPEWGTQ---LLalNQDENGIRADLR---LK-DGTK---QTISPRWVIGADGVRSRVR 180 Sphingobium chlorophe...
P95598  94 LGIPQPEIDRILAEHATEVG-ADIQRGKR---VVaiRQDTDNVAAELS---DGT--------TLHARYLVGCDGGRSTVR 158 Rhodococcus hoagii
O07561  97 LLLPQSKTEKLLEDHARSLG-TEVFRGAE---ALavTQNGEAVQTIFK---DRDGSVR----TITSKFAVGADGAGSTVR 165 Bacillus subtilis sub...
Q54171  92 KTVPQSDTETMLEGWARELG-ADIRRGHE---LVtlHDHGDHVEAEVR---GPEDEKI----RLTAPYLVGCDGGRSTVR 160 Streptomyces fradiae
O65936 149 AMVPQWDLLNLLAEAAQAEPsFTLRMKTE---VTglLREGGKVTGVRY---QGAEGPG----ELRAELTVACDGRWSIAR 218 Mycobacterium tubercu...
Q59744  98 TVYGQTEVTRDLMERREESGsLSIYDAVD---VA--PHDFDGPSPFVT---YVKDGVA---KRIDCDFIAGCDGFHGASR 166 Rhizobium leguminosarum
Q03298 101 TVYGQTEVTKDLMQAREQAGlCSFYESND---VQ--IHDFYN-APKVT---FESNGTH---YQIECDFIAGCDGYHGVCR 168 Acinetobacter baylyi ...
1FOH_D 158 EAYPVTMTLRYMSDH-ESTP-LQFGHKTEnslFHsnLQTQEEEDANYRlpeGKEAGEI---ETVHCKYVIGCDGGHSWVR 232 Cutaneotrichosporon c...
1DOC_A 167 QSIPAErLKVFERVypFGWLGLLADTpPVS---------HELIYANHPRgfa-lcSQRSATRSRYYVQVPLSEKVEDW-- 234 Pseudomonas aeruginosa
O05144 177 KRLGVS-FEGESPStrWLVVDVNNDPlGTP---------NVFLGADPKR------PYVSIGLPHAVRRWEFMLHDDET-- 238 Rhodococcus globerulus
P42535 181 ECLGIA-YEGEDy--eENVLQMM-DV-GIQdfeagddwiHYFIGQDKFVfvt-klPGSN------YRVIISDLGGANK-- 246 Sphingobium chlorophe...
P95598 159 KLRSTSvFPASR-----TSADTLIGEmDVTmpadelaavVAEIRETHKRfg--vgPAGNGAFR---VVVPAAEVADGR-- 226 Rhodococcus hoagii
O07561 166 KQAKIE-FPGTDSTvtAALGDVVLLSpPPS---------GVLSLCTKEGgvm-ivPLSP--DRYRVVVISPYRTQTPK-- 230 Bacillus subtilis sub...
Q54171 161 KAVGFD-FPGTAATmeMYLADIKGVDlKPR-----------LIGETHPGgmvmsgPLGDRGVT-RIIVCERGTPPRRR-- 225 Streptomyces fradiae
O65936 219 HEAGLK----------AREFPVNFDVwWFKlpregdaefSFLPRFSPGKglg-viPREGYFQIAYLGPKGTDAQLRER-- 285 Mycobacterium tubercu...
Q59744 167 KAVPERaIRSFEKIypFGWLGILADVaPVS---------HELIYANHPRgfa-lcSMRSATRSRYYIQCTLDEKIDDW-- 234 Rhizobium leguminosarum
Q03298 169 ASVPQDkIKTFEKVypFGWLGVLADVpPVA---------DELIYVQSERgfa-lcSMRSETRSRYYIQVPLTDHVENW-- 236 Acinetobacter baylyi ...
1FOH_D 233 RTLGFE-MIGEQTDyiWGVLDAVPAS-NFPdir-----srCAIHSAESGsim-iiPREN-NLVRFYVQLQARAEKGGRvd 303 Cutaneotrichosporon c...
1DOC_A 235 SDERFWTELKARLPSEVAEKLVTG-PSLEKSIAPLRSFVVEPMQHG-RLFLAGDAAHIVPPTGAKGLNLAASDVSTLYRL 312 Pseudomonas aeruginosa
O05144 239 EEQVTDPDYVNALLADHVPNPAEL-DFIRRRVFTHHGRVASDFRKG-RQLIAGDAAHLMPVWMGQGWNSGMRDATNLGWK 316 Rhodococcus globerulus
P42535 247 SNLEETREAFQGYLSSFDDHATLD-EPRWATKWRVWKRMATAYRKG-NVFLAGDAAHCHSPSGGSGMNVGMQDAFNLGWK 324 Sphingobium chlorophe...
P95598 227 ATPTTLDDIKQQLLAIAGTDFGVH-SPRWLSRFGDATRLADDYRRD-RVFLAGDAAHIHPPMGGQGLNLGVQDAFNLGWK 304 Rhodococcus hoagii
O07561 231 DVPVTEEELKADLLRICGTDFGLT-DPSWMSRFGNAARQAKRYRDG-RIFLAGDAAHIHFPAGGQGLNVGLQDAMNLGWK 308 Bacillus subtilis sub...
Q54171 226 TEPPSYAEVAAAWQRITGIDISHA-EHEWVSAFGDATRLVTEYRRG-RVLLAGDAAHIHLPAGGQGMNTGIQDAVNLGWK 303 Streptomyces fradiae
O65936 286 GIEEFRRDVSELLPEATASVAALA-SMDEVKHLNVKVNRLRRWHID-GLLCIGDAAHAMSPVAGVGINLAVQDAVAAATI 363 Mycobacterium tubercu...
Q59744 235 SDDRFWDELRRRLPTHHAEALATA-PSFEKSIAPLRSFVAEPMRFG-RLFLVGDAAHIVPPTGAKGLNLAASDVHYLFSG 312 Rhizobium leguminosarum
Q03298 237 SDDQFWEELKNRLDPESCEKLVTG-PSIEKSIAPLRSFVTEPMRFG-KLFLAGDAAHIVPPTGAKGLNLAASDIAYLSSA 314 Acinetobacter baylyi ...
1FOH_D 304 RTKFTPEVVIANAKKIFHPYTFDVqQLDWFTAYHIGQRVTEKFSKDeRVFIAGDACHTHSPKAGQGMNTSMMDTYNLGWK 383 Cutaneotrichosporon c...
1DOC_A 313 LLKAYR-EGRGELLERYSAICLRRIWKAERFS 343 Pseudomonas aeruginosa
O05144 317 LAAVLSgQADDALLDTYTSERKDHAQAMVDLS 348 Rhodococcus globerulus
P42535 325 IAMVERgEAKPDLLDTYHTERTPVAQQLLEGT 356 Sphingobium chlorophenolicum
P95598 305 LAAEINgWAPVGLLDTYESERRPVAADVLDNT 336 Rhodococcus hoagii
O07561 309 LAAAIKgSAPSWLLDSYHDERHPAAEGLLRNT 340 Bacillus subtilis subsp. subtilis str. 168
Q54171 304 LAAVLRgTASESLLDSYHSERHAVGERLMMNT 335 Streptomyces fradiae
O65936 364 LAEPLReHRVSSRHLAAVRRRRAFPTAVTQAV 395 Mycobacterium tuberculosis
Q59744 313 LIEHYR-EGSNSGIDAYSHKALARVWKAVRFS 343 Rhizobium leguminosarum
Q03298 315 LIEFYT-QGSEQGIDQYSEKCLQRVWKAERFS 345 Acinetobacter baylyi ADP1
1FOH_D 384 LGLVLTgRAKRDILKTYEEERHAFAQALIDFD 415 Cutaneotrichosporon cutaneum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap