3BBN,1VS5,3J43,1V9F,1VIO,5Z81,6BYQ,3DH3,5JPQ,2K6P,2TS1,1KSK


Conserved Protein Domain Family
S4

?
pfam01479: S4 
Click on image for an interactive view with Cn3D
S4 domain
The S4 domain is a small domain consisting of 60-65 amino acid residues that was detected in the bacterial ribosomal protein S4, eukaryotic ribosomal S9, two families of pseudouridine synthases, a novel family of predicted RNA methylases, a yeast protein containing a pseudouridine synthetase and a deaminase domain, bacterial tyrosyl-tRNA synthetases, and a number of uncharacterized, small proteins that may be involved in translation regulation. The S4 domain probably mediates binding to RNA.
Statistics
?
PSSM-Id: 366667
View PSSM: pfam01479
Aligned: 128 rows
Threshold Bit Score: 27.845
Threshold Setting Gi: 74967166
Created: 24-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3BBN_D  89 MRLDNIL-FrLGMAPTIPGARQLVNHRHILVNGRIVDIPSYRCKPQDTI 136 spinach
P74346  32 VRLDKWL-AeQLPELSRSRCQKLIESGQVQRNGLVCQDKNLILKTGDRL 79  Synechocystis sp. PCC 6803 substr. Kazusa
P74082 184 LRLDAIA-S-AGFGLSRSKMADAVTQGNVQVNWKPVTQSSYALKAGDLV 230 Synechocystis sp. PCC 6803
P71020 181 LRLDAVC-AsMSRQ-SRQKSQTLVKNGLVKVNWKVVEDPSYIVAEGDML 227 Bacillus subtilis subsp. subtilis str. 168
Q9RTH5  31 GRLDAVV-S-LLSGVSRSQVAGWIEAGLVEIDGRAASKASQKLRGGEAL 77  Deinococcus radiodurans
O84665  21 GRLDKGL-VsYNGAYSRAFYQQQIELGRVRVNGRVYTRVSHPLSLGDVV 68  Chlamydia trachomatis
Q9RW82 162 MRVDVVG-A-KGFGVSRAYFQQGIDGGKVRLNGQSAR-ASSEIREGDSL 207 Deinococcus radiodurans
Q9WYT3  13 WRLDQFLkEkTPSWISRSMIQKAIKEGKVKVNGQIKK-PSYKLKEGEIV 60  Thermotoga maritima
Q45480  15 ERIDKFL-AsTENDWSRTQVQQWVKDGQVVVNGSAVK-ANYKIQPGDQV 61  Bacillus subtilis subsp. subtilis str. 168
O67638  16 ERLDKFL-ArAYPDFSRSYIKKLVKEGLVYVNGEEVRKPSRKLREGERV 63  Aquifex aeolicus VF5
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap