1X4V,1WFP


Conserved Protein Domain Family
zf-AN1

?
pfam01428: zf-AN1 
Click on image for an interactive view with Cn3D
AN1-like Zinc finger
Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis. The following pattern describes the zinc finger. C-X2-C-X(9-12)-C-X(1-2)-C-X4-C-X2-H-X5-H-X-C Where X can be any amino acid, and numbers in brackets indicate the number of residues.
Statistics
?
Aligned: 461 rows
Threshold Bit Score: 26.1098
Threshold Setting Gi: 0
Created: 11-Jun-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1X4V_A              15 CERAGCRQREMMK-LTCERCSRNFCIKHRHPLDHDCSG 51  human
EPY53138           143 CSHPTCTKMTLRLtGHCLHCDLGYCAAHRLMEDHDCSA 180 Schizosaccharomyces cryophilus OY26
CCE65559            93 CHYKDCSSSYIKYiGECQYCEGRFCSQHRLLETHLCTK 130 Tetrapisispora phaffii CBS 4417
EGN95392            10 fseTRCSSAVVRIvGQCPLCRADFCGEHRLPEHHNCNN 47  Serpula lacrymans var. lacrymans S7.3
ESK96846            12 gteDQCNSAALRLvGQCPHCRNQFCGDHRLPEHHSCNK 49  Moniliophthora roreri MCA 2997
EMD38442            10 qaePRCNSAVLRLvGQCPHCRAEFCSAHRMPEHHNCQN 47  Gelatoporia subvermispora B
WGS:AEVR:RTG_01240  86 T--DRCSQAAVRIvGDCQLCSASFCSRHRLAEDHSCPK 121 Rhodotorula toruloides ATCC 204091
KDE04925            87 T--DRCSQASLRIvGDCSFCSTSFCGRHRLPEDHKCAN 122 Microbotryum lychnidis-dioicae p1A1 Lamole
XP_018653035       103 CDYHLCNQRQLVL-LSCDGCYGNFCTSHKQKEVHQCSG 139 Schistosoma mansoni
CCA69241             7 CQLDGCRNAVQRIaGECSHCSSHYCTSHRLPETHACGK 44  Serendipita indica DSM 11827
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap