2QY7,4GZD,3ONK,5CMW


Conserved Protein Domain Family
ENTH

?
pfam01417: ENTH 
Click on image for an interactive view with Cn3D
ENTH domain
The ENTH (Epsin N-terminal homology) domain is found in proteins involved in endocytosis and cytoskeletal machinery. The function of the ENTH domain is unknown.
Statistics
?
PSSM-Id: 334530
View PSSM: pfam01417
Aligned: 66 rows
Threshold Bit Score: 82.9804
Threshold Setting Gi: 74856228
Created: 17-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2QY7_A         2 YSEIESKVREATNDDPW-GP--SGQLMGEIAKATFMyEQFPELMNMLWSRMl-----K--DNKKNWRRVYK--------- 62  human
Q07872        12 QSPTESKVKQATNEDETsGA--TGTLMNEISILTYSpKTVREIIQVIRKRLllgqnrR--NSHRNCIQVMK--------- 78  Saccharomyces c...
Q6FV92        12 LSPTELKVRQATDDNELaGA--TGTLMNEISVLTYSkKTLKDVIQVIRKRLsg---vNkrNSHRTCLHVLK--------- 77  [Candida] glabrata
Q75CI0        12 SSPTAAKVRKATDDNEFvGA--SSALISEITILTYScKTLLDVTRVLKKRLsg---nAnkSSHKNAVHILK--------- 77  Eremothecium go...
A0CFU3        19 KSPLEQTLSEATSNENW-NT--PTKLLQEVAEASYGyTSCDTIMKFIWKRL------D--SDNREWRRILK--------- 78  Paramecium tetr...
A0E2V0       386 YTPEEQALKLFDQAYHYdSSilPINLLDQIAELSFQmEHYPKIINQIVLQL------S--TIGISSNVILK--------- 448 Paramecium tetr...
Q4N8B4        21 SGELDKCLREALFSDSV-GC--SDSILYDISQATYHeVFFQKIMKSTWKCI------S--SSPRRVKRIQK--------- 80  Theileria parva
Q7R6W4        24 SNQFEKNLKEALNNKNY-GV--SNSLLYDLSISTYDaTYYKRVISEVFKAI------Q--EKPSKWRRIYKvglkiktkn 92  Plasmodium yoel...
Q5CW24        28 LTQLEKWLKEATSNTNW-GC--SSTILNEIARSMTDyHDYVLVQKCIGDCL------S--EKAIKWRRIFK--------- 87  Cryptosporidium...
XP_001642820  12 QSATEAKVKEATDDNETsGA--TGTLMNEISVLTYSpKTLKEIIQVLKKRLtg---sSkkSSHRNCVHILK--------- 77  Vanderwaltozyma...
2QY7_A        63 SLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHF-VDE-HGKDQGINIRQKVKELVEFAQDDDRL 126 human
Q07872        79 TLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQV-QDP-RDERKAEDIQKLSRNVLGLLQDDGLl 142 Saccharomyces cerevisiae S288c
Q6FV92        78 TLTLVSYLLNNGSNDFIAWLKSSKYVIEYLSSFEA-QSS-SDEPMVNQIRFLCNDIITLLEDEELL 141 [Candida] glabrata
Q75CI0        78 ALTLTNYLIANGSEDFVQWLQGCAVLLRRLKDFTT-GNE-RDSHMASQIRSFSLSLLELMQNPALL 141 Eremothecium gossypii
A0CFU3        79 TLNMIEYLTKNGAPRCVGEFRDNIYKIRSFSDFFL-VEQ--GSDKGLSIRDKTKQLVDLLSNEKLI 141 Paramecium tetraurelia
A0E2V0       449 TLIITDYLLKYGCSGIIDDLKVRIYMFRNYQDFKIdFQE----PIYITIRQKAGNIANQLSNRKLL 510 Paramecium tetraurelia
Q4N8B4        81 ALNLLNYLIINGSDRCIYDVMNNLHILSSVGKLKF---SpANRALGHLVSDKAAQIAALVLDNRTL 143 Theileria parva
Q7R6W4        93 GLRLCEYVMKNGCEYFISDVKEKEELIKKLAHFTY-LEN--LRDKGVGIREISNNILNLLRDNKYL 155 Plasmodium yoelii yoelii
Q5CW24        88 TLVLVEYLLKNGIDRFVDDFKEYMYKVRHLQDFYY-TEE--GKDKGAGIREKSKCILNLINDPMLL 150 Cryptosporidium parvum
XP_001642820  78 TMTLISYLINNGSNDFIAWARSNIMIFEVLKDFEV-IHE-DDEKMAEQIRYIAGDLCILINDDELL 141 Vanderwaltozyma polyspora DSM...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap