1LI5


Conserved Protein Domain Family
tRNA-synt_1e

?
pfam01406: tRNA-synt_1e 
Click on image for an interactive view with Cn3D
tRNA synthetases class I (C) catalytic domain
This family includes only cysteinyl tRNA synthetases.
Statistics
?
PSSM-Id: 279714
View PSSM: pfam01406
Aligned: 10 rows
Threshold Bit Score: 489.186
Threshold Setting Gi: 1351621
Created: 14-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1LI5_B  15 FKPIHAGEVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLRF-LGYKLKYVRNITDIDDKIIKRANENGES--------- 84  Escherichia coli
P9WFW1  20 FVPLRPGHVSIYLCGATVQGLPHIGHVRSGVAFDILRRWLLA-RGYDVAFIRNVTDIEDKILAKAAAAGRP--------- 89  Mycobacterium tubercu...
P75423  18 SVVLEQKQINIYLCGPTVYNDLHLGNTRPLIVFDVLQRVLQA-AQYKVQFVQNITDIDDKIIKIAQQQEIS--------- 87  Mycoplasma pneumoniae...
Q09860  35 VSNGSN--LTWYCCGPTVYDASHMGHARNYVTTDILRRILQSyFGYNITFVQNVTDIDDKIILRARQQYLFeeykkqqgt 112 Schizosaccharomyces p...
P43816  15 FKPIHENKVGMYVCGVTVYDLCHIGHGRTFVCFDVIARYLRS-LGYDLTYVRNITDVDDKIIKRALENKET--------- 84  Haemophilus influenza...
P53852  50 IPQSGNRGVTWYSCGPTVYDASHMGHARNYVSIDINRRIIQDyFGYDVQFVQNVTDIDDKIILRARQNYLFdnfvkendt 129 Saccharomyces cerevis...
P74330  16 LQPLHPGLVTMYCCGITVYDYCHLGHARTCITWDLVRRYLQW-SGYEVRYVQNFTDIDDKILKRAVDESST--------- 85  Synechocystis sp. PCC...
Q06752  16 FVPLEEGKVKMYVCGPTVYNYIHIGNARPAIVYDTVRNYLEY-KGYDVQYVSNFTDVDDKLIKAANELGED--------- 85  Bacillus subtilis sub...
O29836  15 EDIVDGKRVKMYVCGITAYDYSHIGHARSAVFFDVFRRYLEY-LGYEVVYVQNFTDVDDKIINRAVKEGKT--------- 84  Archaeoglobus fulgidu...
P41259  14 FEPLVQNKANIYVCGPTVYDDAHLGHARSAIAFDLLRRTLEL-SGYEVMLVRNFTDIDDKIINKALKENKS--------- 83  Helicobacter pylori 2...
1LI5_B     -------------------------------------------------------------------------------- Escherichia coli
P9WFW1     -------------------------------------------------------------------------------- Mycobacterium tubercu...
P75423     -------------------------------------------------------------------------------- Mycoplasma pneumoniae...
Q09860 113 nkshsearekvteawfayakknlpeppssmsewpqwlashdiptlainnpklpmhvdalksaldalqvseaseiisldgf 192 Schizosaccharomyces p...
P43816     -------------------------------------------------------------------------------- Haemophilus influenza...
P53852 130 kfnatvvdkvktalfqyinknftiqgseiktieefetwlsnadtetlk-lenpkfpmhvtavqnaiesitkgdsmdaeva 208 Saccharomyces cerevis...
P74330     -------------------------------------------------------------------------------- Synechocystis sp. PCC...
Q06752     -------------------------------------------------------------------------------- Bacillus subtilis sub...
O29836     -------------------------------------------------------------------------------- Archaeoglobus fulgidu...
P41259     -------------------------------------------------------------------------------- Helicobacter pylori 2...
1LI5_B  85 -------------------------FVAMVDRMIAEMHKDFDALNILRPDMEPRATHHIAEIIELTEQLIAKGHAYVADn 139 Escherichia coli
P9WFW1  90 -------------------------WWEWAATHERAFTAAYDALDVLPPSAEPRATGHITQMIEMIERLIQAGHAYTGG- 143 Mycobacterium tubercu...
P75423  88 -------------------------EAQLCKQQITAYKSLLKKLNILP-IKHLQVTDKIDKMPGYIARLVKKGFAYVSPl 141 Mycoplasma pneumoniae...
Q09860 193 wpkvqdvlvplldaelgstvtdpaiFRKLAAYWEDDFNKDMANLNVLPPTAVTRVSEYVPEIVDFVQRIIDRGYAYPVTd 272 Schizosaccharomyces p...
P43816  85 -------------------------CDQLVDRMVQEMYKDFDALNVLRPDFEPRATHHIPEIIEIVEKLIKRGHAYVADn 139 Haemophilus influenza...
P53852 209 fekvkdvtvplldkelgstisnpeiFRQLPAYWEQKFNDDMLSLNVLPPTVTTRVSEYVPEIIDFVQKIIDNGYAYATSd 288 Saccharomyces cerevis...
P74330  86 -------------------------MEAVSEKFIAAYFEDMEALGVQPADLYPRATHTLDGIKRLIAELEAKGYAYPSG- 139 Synechocystis sp. PCC...
Q06752  86 -------------------------VPTISERFIKAYFEDVGALGCRKADLHPRVMENMDAIIEFVDQLVKKGYAYESE- 139 Bacillus subtilis sub...
O29836  85 -------------------------QKEVAEKFIEEYLKDMEALNVKKPTYQPKVTEHIPDIIEFIQNLIEKGYAYVID- 138 Archaeoglobus fulgidu...
P41259  84 -------------------------IQELSSIYIESYTRDLNALNVKKPSLEPKASEYLDAMVGMIETLLEKNIAYQVSn 138 Helicobacter pylori 2...
1LI5_B 140 -----GDVMFDVPTDPTYGVLSRQDLDQLQAGARVDVv------dDKRNPMDFVLWKMSKEGE----PSWPSPWGAGRPG 204 Escherichia coli
P9WFW1 144 -----GDVYFDVLSYPEYGQLSGHKIDDVHQGEGVAA--------GKRDQRDFTLWKGEKPGE----PSWPTPWGRGRPG 206 Mycobacterium tubercu...
P75423 142 -----GNTYFSVSQLPQYGILANRVVETIEDEATD-----------KRNKLDFVLWKQTTAG-----VKWNSPWGWGRPG 200 Mycoplasma pneumoniae...
Q09860 273 gsvyfDTEAFEKG-GHFYAKLEPWNKGNRELIAEGEGsla--altGKKRPGDFALWKASKPGE----PSWDSPWSKGRPG 345 Schizosaccharomyces p...
P43816 140 -----GDVMFDVESFKEYGKLSRQDLEQLQAGARIEIn------eIKKNPMDFVLWKMSKENE----PSWASPWGAGRPG 204 Haemophilus influenza...
P53852 289 gsvyfDTLKFDKSPNHDYAKCQPWNKGQLDLINDGEGslsnfadnGKKSNNDFALWKASKAGE----PEWESPWGKGRPG 364 Saccharomyces cerevis...
P74330 140 -----GDVYYSVRNFDGYGKLSGRRLEDLQAGASGRVtvadpdgaQKQDPFDFALWKSAKPGE----PAWESPWGKGRPG 210 Synechocystis sp. PCC...
Q06752 140 -----GDVYFKTRAFEGYGKLSQQSIDELRSGARIRVg------eKKEDALDFALWKAAKEGE----ISWDSPWGKGRPG 204 Bacillus subtilis sub...
O29836 139 -----GDVYFHVPAFEHYGELSKQSLEELNRHRIEPDe-------RKRDVKDFALWKSAKEADlkaqAVFDSPWGRGRPG 206 Archaeoglobus fulgidu...
P41259 139 -----GDIYLDTSKDKDYGSLSVHNSS-IEFGRIGLVq-------EKRLEQDFVLWKSYKGDNd---VGFDSPLGKGRPG 202 Helicobacter pylori 2...
1LI5_B 205 WHIECSAMNCKQLG-----NHFDIHGGGSDLMFPHHENEIAQSTCAHDg-QYVNYWMHSGMVMVDREKMSKSLGNFFTVR 278 Escherichia coli
P9WFW1 207 WHLECSAMARSYLG-----PEFDIHCGGMDLVFPHHENEIAQSRAAGD--GFARYWLHNGWVTMGGEKMSKSLGNVLSMP 279 Mycobacterium tubercu...
P75423 201 WHVECAFLIDYSFK-----DQLTIHGGGVDLKFPHHENENAMHMALYDk-PLTQHWMHIGHLMFENQKMSKSLQNFLLAV 274 Mycoplasma pneumoniae...
Q09860 346 WHIECSVMASALLG-----SNIDIHSGGIDLAFPHHDNELAQSEAYFDcpQWVNYFFHAGHLHIEGQKMSKSLKNFITIK 420 Schizosaccharomyces p...
P43816 205 WHIECSAMNCKQLG-----EYFDIHGGGSDLMFPHHENEIAQSCCAHGg-QYVNYWIHSGMIMVDKEKMSKSLGNFFTIR 278 Haemophilus influenza...
P53852 365 WHIECSVMASDILG-----SNIDIHSGGIDLAFPHHDNELAQSEARFDnqQWINYFLHTGHLHIEGQKMSKSLKNFITIQ 439 Saccharomyces cerevis...
P74330 211 WHIECSAMVREFLG-----ETIDLHVGGNDLIFPHHENEIAQSEAVTGq-PLAQYWLHNGMVKVDGEKMSKSLGNFTTIR 284 Synechocystis sp. PCC...
Q06752 205 WHIECSAMVKKYLG-----DQIDIHAGGQDLTFPHHENEIAQSEALTGk-TFAKYWLHNGYINIDNEKMSKSLGNFVLVH 278 Bacillus subtilis sub...
O29836 207 WHIECSVMSAKYLG-----VPFDIHGGGKDLIFPHHENERAQSFARFGv-EPVKIWVHNDFIRIKGEKMSKSLGNIVRIR 280 Archaeoglobus fulgidu...
P41259 203 WHIECSSMVFETLAltntpYQIDIHAGGADLLFPHHENEACQTRCAFGv-ELAKYWMHNGFVNINNEKMSKSLGNSFFVK 281 Helicobacter pylori 2...
1LI5_B 279 DVLKYYDAETVRYFLMSGHYRSQLNYSEENLKQAR 313 Escherichia coli
P9WFW1 280 AMLQRVRPAELRYYLGSAHYRSMLEFSETAMQDAV 314 Mycobacterium tuberculosis H37Rv
P75423 275 DFLTIHDFRILRWLFYQKHYYHPLDLSQSLIEQAC 309 Mycoplasma pneumoniae M129
Q09860 421 EILKKFTPRQLRLAFLLQQWNTQLDFKETLLAYVL 455 Schizosaccharomyces pombe 972h-
P43816 279 DVLNHYNAEAVRYFLLTAHYRSQLNYSEENLNLAQ 313 Haemophilus influenzae Rd KW20
P53852 440 EALKKFSPRQLRLAFASVQWNNQLDFKESLIHEVK 474 Saccharomyces cerevisiae S288c
P74330 285 ALLKTVDPMAIRLLVLQGHYRKPLDFTETAIAAAT 319 Synechocystis sp. PCC 6803 substr. Kazusa
Q06752 279 DIIKQHDPQLLRFFMLSVHYRHPINYSEELLENTK 313 Bacillus subtilis subsp. subtilis str. 168
O29836 281 DVLQRYEGEVLRYFLLTAHYRSPLDYTEEALERAK 315 Archaeoglobus fulgidus DSM 4304
P41259 282 DALKNYDGEILRNYLLGVHYRSVLNFNEEDLLVSK 316 Helicobacter pylori 26695
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap