1LI5


Conserved Protein Domain Family
tRNA-synt_1e

?
pfam01406: tRNA-synt_1e 
Click on image for an interactive view with Cn3D
tRNA synthetases class I (C) catalytic domain
This family includes only cysteinyl tRNA synthetases.
Statistics
?
PSSM-Id: 279714
View PSSM: pfam01406
Aligned: 10 rows
Threshold Bit Score: 489.186
Threshold Setting Gi: 1351621
Created: 14-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1LI5_B        15 FKPIHAGEVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLRF-LGYKLKYVRNITDIDDKIIKRANENGES--------- 84
gi 614139086  20 FVPLRPGHVSIYLCGATVQGLPHIGHVRSGVAFDILRRWLLA-RGYDVAFIRNVTDIEDKILAKAAAAGRP--------- 89
gi 2500964    18 SVVLEQKQINIYLCGPTVYNDLHLGNTRPLIVFDVLQRVLQA-AQYKVQFVQNITDIDDKIIKIAQQQEIS--------- 87
gi 1351621    35 VSNGSN--LTWYCCGPTVYDASHMGHARNYVTTDILRRILQSyFGYNITFVQNVTDIDDKIILRARQQYLFeeykkqqgt 112
gi 1174501    15 FKPIHENKVGMYVCGVTVYDLCHIGHGRTFVCFDVIARYLRS-LGYDLTYVRNITDVDDKIIKRALENKET--------- 84
gi 1730840    50 IPQSGNRGVTWYSCGPTVYDASHMGHARNYVSIDINRRIIQDyFGYDVQFVQNVTDIDDKIILRARQNYLFdnfvkendt 129
gi 2500966    16 LQPLHPGLVTMYCCGITVYDYCHLGHARTCITWDLVRRYLQW-SGYEVRYVQNFTDIDDKILKRAVDESST--------- 85
gi 549024     16 FVPLEEGKVKMYVCGPTVYNYIHIGNARPAIVYDTVRNYLEY-KGYDVQYVSNFTDVDDKLIKAANELGED--------- 85
gi 3122884    15 EDIVDGKRVKMYVCGITAYDYSHIGHARSAVFFDVFRRYLEY-LGYEVVYVQNFTDVDDKIINRAVKEGKT--------- 84
gi 2507427    14 FEPLVQNKANIYVCGPTVYDDAHLGHARSAIAFDLLRRTLEL-SGYEVMLVRNFTDIDDKIINKALKENKS--------- 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1LI5_B           --------------------------------------------------------------------------------
gi 614139086     --------------------------------------------------------------------------------
gi 2500964       --------------------------------------------------------------------------------
gi 1351621   113 nkshsearekvteawfayakknlpeppssmsewpqwlashdiptlainnpklpmhvdalksaldalqvseaseiisldgf 192
gi 1174501       --------------------------------------------------------------------------------
gi 1730840   130 kfnatvvdkvktalfqyinknftiqgseiktieefetwlsnadtetlk-lenpkfpmhvtavqnaiesitkgdsmdaeva 208
gi 2500966       --------------------------------------------------------------------------------
gi 549024        --------------------------------------------------------------------------------
gi 3122884       --------------------------------------------------------------------------------
gi 2507427       --------------------------------------------------------------------------------
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1LI5_B        85 -------------------------FVAMVDRMIAEMHKDFDALNILRPDMEPRATHHIAEIIELTEQLIAKGHAYVADn 139
gi 614139086  90 -------------------------WWEWAATHERAFTAAYDALDVLPPSAEPRATGHITQMIEMIERLIQAGHAYTGG- 143
gi 2500964    88 -------------------------EAQLCKQQITAYKSLLKKLNILP-IKHLQVTDKIDKMPGYIARLVKKGFAYVSPl 141
gi 1351621   193 wpkvqdvlvplldaelgstvtdpaiFRKLAAYWEDDFNKDMANLNVLPPTAVTRVSEYVPEIVDFVQRIIDRGYAYPVTd 272
gi 1174501    85 -------------------------CDQLVDRMVQEMYKDFDALNVLRPDFEPRATHHIPEIIEIVEKLIKRGHAYVADn 139
gi 1730840   209 fekvkdvtvplldkelgstisnpeiFRQLPAYWEQKFNDDMLSLNVLPPTVTTRVSEYVPEIIDFVQKIIDNGYAYATSd 288
gi 2500966    86 -------------------------MEAVSEKFIAAYFEDMEALGVQPADLYPRATHTLDGIKRLIAELEAKGYAYPSG- 139
gi 549024     86 -------------------------VPTISERFIKAYFEDVGALGCRKADLHPRVMENMDAIIEFVDQLVKKGYAYESE- 139
gi 3122884    85 -------------------------QKEVAEKFIEEYLKDMEALNVKKPTYQPKVTEHIPDIIEFIQNLIEKGYAYVID- 138
gi 2507427    84 -------------------------IQELSSIYIESYTRDLNALNVKKPSLEPKASEYLDAMVGMIETLLEKNIAYQVSn 138
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1LI5_B       140 -----GDVMFDVPTDPTYGVLSRQDLDQLQAGARVDVv------dDKRNPMDFVLWKMSKEGE----PSWPSPWGAGRPG 204
gi 614139086 144 -----GDVYFDVLSYPEYGQLSGHKIDDVHQGEGVAA--------GKRDQRDFTLWKGEKPGE----PSWPTPWGRGRPG 206
gi 2500964   142 -----GNTYFSVSQLPQYGILANRVVETIEDEATD-----------KRNKLDFVLWKQTTAG-----VKWNSPWGWGRPG 200
gi 1351621   273 gsvyfDTEAFEKG-GHFYAKLEPWNKGNRELIAEGEGsla--altGKKRPGDFALWKASKPGE----PSWDSPWSKGRPG 345
gi 1174501   140 -----GDVMFDVESFKEYGKLSRQDLEQLQAGARIEIn------eIKKNPMDFVLWKMSKENE----PSWASPWGAGRPG 204
gi 1730840   289 gsvyfDTLKFDKSPNHDYAKCQPWNKGQLDLINDGEGslsnfadnGKKSNNDFALWKASKAGE----PEWESPWGKGRPG 364
gi 2500966   140 -----GDVYYSVRNFDGYGKLSGRRLEDLQAGASGRVtvadpdgaQKQDPFDFALWKSAKPGE----PAWESPWGKGRPG 210
gi 549024    140 -----GDVYFKTRAFEGYGKLSQQSIDELRSGARIRVg------eKKEDALDFALWKAAKEGE----ISWDSPWGKGRPG 204
gi 3122884   139 -----GDVYFHVPAFEHYGELSKQSLEELNRHRIEPDe-------RKRDVKDFALWKSAKEADlkaqAVFDSPWGRGRPG 206
gi 2507427   139 -----GDIYLDTSKDKDYGSLSVHNSS-IEFGRIGLVq-------EKRLEQDFVLWKSYKGDNd---VGFDSPLGKGRPG 202
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1LI5_B       205 WHIECSAMNCKQLG-----NHFDIHGGGSDLMFPHHENEIAQSTCAHDg-QYVNYWMHSGMVMVDREKMSKSLGNFFTVR 278
gi 614139086 207 WHLECSAMARSYLG-----PEFDIHCGGMDLVFPHHENEIAQSRAAGD--GFARYWLHNGWVTMGGEKMSKSLGNVLSMP 279
gi 2500964   201 WHVECAFLIDYSFK-----DQLTIHGGGVDLKFPHHENENAMHMALYDk-PLTQHWMHIGHLMFENQKMSKSLQNFLLAV 274
gi 1351621   346 WHIECSVMASALLG-----SNIDIHSGGIDLAFPHHDNELAQSEAYFDcpQWVNYFFHAGHLHIEGQKMSKSLKNFITIK 420
gi 1174501   205 WHIECSAMNCKQLG-----EYFDIHGGGSDLMFPHHENEIAQSCCAHGg-QYVNYWIHSGMIMVDKEKMSKSLGNFFTIR 278
gi 1730840   365 WHIECSVMASDILG-----SNIDIHSGGIDLAFPHHDNELAQSEARFDnqQWINYFLHTGHLHIEGQKMSKSLKNFITIQ 439
gi 2500966   211 WHIECSAMVREFLG-----ETIDLHVGGNDLIFPHHENEIAQSEAVTGq-PLAQYWLHNGMVKVDGEKMSKSLGNFTTIR 284
gi 549024    205 WHIECSAMVKKYLG-----DQIDIHAGGQDLTFPHHENEIAQSEALTGk-TFAKYWLHNGYINIDNEKMSKSLGNFVLVH 278
gi 3122884   207 WHIECSVMSAKYLG-----VPFDIHGGGKDLIFPHHENERAQSFARFGv-EPVKIWVHNDFIRIKGEKMSKSLGNIVRIR 280
gi 2507427   203 WHIECSSMVFETLAltntpYQIDIHAGGADLLFPHHENEACQTRCAFGv-ELAKYWMHNGFVNINNEKMSKSLGNSFFVK 281
                        410       420       430
                 ....*....|....*....|....*....|....*
1LI5_B       279 DVLKYYDAETVRYFLMSGHYRSQLNYSEENLKQAR 313
gi 614139086 280 AMLQRVRPAELRYYLGSAHYRSMLEFSETAMQDAV 314
gi 2500964   275 DFLTIHDFRILRWLFYQKHYYHPLDLSQSLIEQAC 309
gi 1351621   421 EILKKFTPRQLRLAFLLQQWNTQLDFKETLLAYVL 455
gi 1174501   279 DVLNHYNAEAVRYFLLTAHYRSQLNYSEENLNLAQ 313
gi 1730840   440 EALKKFSPRQLRLAFASVQWNNQLDFKESLIHEVK 474
gi 2500966   285 ALLKTVDPMAIRLLVLQGHYRKPLDFTETAIAAAT 319
gi 549024    279 DIIKQHDPQLLRFFMLSVHYRHPINYSEELLENTK 313
gi 3122884   281 DVLQRYEGEVLRYFLLTAHYRSPLDYTEEALERAK 315
gi 2507427   282 DALKNYDGEILRNYLLGVHYRSVLNFNEEDLLVSK 316
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap