Conserved Protein Domain Family
PRTP

?
pfam01366: PRTP 
Herpesvirus processing and transport protein
The members of this family are associate with capsid intermediates during packaging of the virus.
Statistics
?
Aligned: 12 rows
Threshold Bit Score: 720.739
Threshold Setting Gi: 81920565
Created: 24-Apr-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6UDK3        40 TRRLLAVAGQLQTLLFQIELLKRCDPEVLVKralrAKIKHNALMVLYLHSRLAGDLAAQAAHRLTVGIYCLWMWLRRACS 119 Psittacid herpe...
O36361         2 GQYLAALYSQIYGLCLDVSLVEFCKPTSLCL----TKIADACNKVHKIHEYVSASLLQQNSLEACALSLELSHLLENLKT 77  Alcelaphine her...
YP_001129509   2 SGLLAAAYSQVYALAVELSVCARLDPRSLDV----AAVVRNAGLLAELEAILLPRLRRQNDRACSALSLELVHLLENSRE 77  Epstein-Barr vi...
P52544         4 LQSLCVLCARLNECALDLECLKFCDPVIVLSd--mANFKKNGIVILHLYQTFFEGIKEQNLLCASALTVYMQVLLKAMYE 81  Human herpesvir...
P30674         6 LQKLCVVCSKCNECAMDVECLKYCDPNIVSMd--sTAFRRNGVMVIHLYRTLYPALVSQNAVQTSVLTLYMEMLLQGLYD 83  Murine cytomega...
F5HC79         6 LQKLCVVCSKCNEYAMELECLKYCDPNVLLAe--sTPFKRNAAAIVYLYRKIYPEVVAQNRTQSSLLTLYLEMLLKALHE 83  Human herpesvir...
Q77MS2        21 TQKLFAIWGQIQSYLFQVELLKRCDPTVGVRm--iNRLKLNVLMIYYLEKKMVPALKEQREMNLTPLTYGLWLALRRAKL 98  Marek's disease...
P09284         6 NRTLLVLLGQVYTYIFQVELLRRCDPRVACRf--lYRLAANCLTVRYLLKLFLRGFNTQLKFGNTPTVCALHWALCYVKG 83  Human herpesvir...
P89451        16 RQKLLALLGQVQTYVFQLELLRRCDPQIGLGk--lAQLKLNALQVRVLRRHLRPGLEAQAAAFLTPLSVTLELLLEYAWR 93  Human herpesvir...
P24911         2 AQHLAAVYSQIYGLTLDVSILTFVDPAHINW----KTVTKNTEKINKIYLQIMPLLHNQNNIESTSLSVELQHLLHNLKI 77  Herpesvirus sai...
Q2HRD2         2 AKELAAVYADVSALAMDLCLLSYADPATLDT----KSLALTTGKFQSLHGTLLPLLRRQNAHECSGLSLELEHLLENVAD 77  Human herpesvir...
Q66612         2 ARELAAVYAQVFDLAAEVSLLGYCDPSSIDK----RCVMANSNKVFKLCESLLPCLRLQNDTECSPLSLELQHLLQNTRE 77  Equid herpesvir...
Q6UDK3       120 EAAALANEIdty---------atyRDKDRFFSATMn-lSPggtCRLHSLV----------GLSLYGrTQDVTRELGLIND 179 Psittacid herpe...
O36361        78 RLFFIYHAL---------------LDNPTYFSKLHssvGL---CDLHKKL----------NVQFYN-ECGIEVNLTLIND 128 Alcelaphine her...
YP_001129509  78 As-----------------------------------aALlapGRKGTRVpplrtpsvaySVEFYG-GHKVDVSLCLIND 121 Epstein-Barr vi...
P52544        82 QVLLLDAALesf---------mvdQDRKKYFEKVL----ClkrCAEHLSI----------NISLNN-GVEFIVQLSTLND 137 Human herpesvir...
P30674        84 TMREIDMALtdf---------gthRDRQRYYRRVL----KldsCNRHESI----------TITFAP-ELALTIDLATLND 139 Murine cytomega...
F5HC79        84 DTALLDRALmay---------srqPDRAAFYRTVL----RldrCDRHHTV----------ELQFTD-NVRFSVSLATLND 139 Human herpesvir...
Q77MS2        99 EGELLLDALcef---------kdgGNLRDFFRKSM---SMcgdCPYHSTV----------ELDTYG--GKVSTEIKFLHD 154 Marek's disease...
P09284        84 EGERLFELLqhfktrfvygetkdsNCIKDYFVSAF----NlktCQYHHEL----------SLTTYG--GYVSSEIQFLHD 147 Human herpesvir...
P89451        94 EGERLLGHLetf---------attGDVSAFFTETM---GLarpCPYHQQI----------RLQTYG--GDVRMELCFLHD 149 Human herpesvir...
P24911        78 VLETFSAHLsdy---------------nmYFENIH---SLsapCSRHKSI----------VFQFYN-NCCVSVKMCIIND 128 Herpesvirus sai...
Q2HRD2        78 ALTTLGVCTsr------------kLSPEEHFSLLH----LditCNKHRSV----------RFNFYG-NWALELKLSLIND 130 Human herpesvir...
Q66612        78 ALGVLTDLLsg------------dPSRSEYFEALHpsrPLegpCKRHARV----------RVPFYG-GAEKTVSLSLLND 134 Equid herpesvir...
Q6UDK3       180 AENLLKQINYCHLIVSTESAEAALVGVDEFLTATVGGGMVASPETYDHTQPCCICLDELSVTANQGDTIYKRLGYSVCDH 259 Psittacid herpe...
O36361       129 IERFLSRLNCVFYCLSSSSALLALKEALTFLGQLRGISPVPRTDIYITSSSCLECVLETSVVPNQGETLNELLLNHNCHH 208 Alcelaphine her...
YP_001129509 122 IEILMKRINSVFYCMSHTMGLESLERALDLLGRFRGVSPIPDPRLYITSVPCWRCVGELMVLPNHGNPSTAEGTHVSCNH 201 Epstein-Barr vi...
P52544       138 IEQLISKINSVYALLLPQEGLQICGKIIDLLTIMCGACMVAKPESYLETKTCMKCYEELTLTPNQGKSLRKRLHGKFCNH 217 Human herpesvir...
P30674       140 VERLLCKINCVYGAVDASQGVAVCRRLLSLLARLCDICPVAGPEIYRETVTCFQCYEELMAVPNQGRSINRRMQGLLCDH 219 Murine cytomega...
F5HC79       140 IERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGTTCAQCYEELTIIPNQGRSLNKRLQGLLCNH 219 Human herpesvir...
Q77MS2       155 VENVLKQLNYCHLILKADTVENFMVSLDNYLLKTLGSGSVVPPELYDPSQPCSVCFEELCVTANSGDSTHKRIVRKICDH 234 Marek's disease...
P09284       148 IENFLKQLNYCYIITSSREALNTLETVTRFMTDTIGSGLIPPVELFDPAHPCAICFEELCITANQGETLHRRLLGCICDH 227 Human herpesvir...
P89451       150 VENFLKQLNYCHLITPPSGATAALERVREFMVAAVGSGLIVPPELSDPSHPCAVCFEELCVTANQGATIARRLADRICNH 229 Human herpesvir...
P24911       129 IEIFSKRLSSVFYCIRSCDALRGINHVIDFLGHLRGVSPIPLPDTYLSNIPCIYCLNEHMMLPNQGESLPSLMMCVNCKH 208 Herpesvirus sai...
Q2HRD2       131 VEIFFKRLSSVFYCIGSGSALEGLGEVLRFVGKLRGISPVPGPDLYVSNLPCLECLQEVCLTPNQGTSLQAMLPDTACSH 210 Human herpesvir...
Q66612       135 VEVFFKRLNSVFYCLPAEGALEALGETVAFLGRLRGVSPIPPADAYVSSVPCASCFAEAAMLPNQGESVLSMLAAVNCNH 214 Equid herpesvir...
Q6UDK3       260 LVKQvkvnvt----------pddvlRHMPFLNSVDANTLRGAIDKLRgssggevgggrrlagvvptgcraevgRSEQEDG 329 Psittacid herpe...
O36361       209 LVER---------------------VPPEPIKGLFESELQNLGLKVHiat---------------------dtIEQSVGK 246 Alcelaphine her...
YP_001129509 202 LAVP---------------------VNPEPVSGLFENEVRQAGLGHLlea---------------------eeKARPGGP 239 Epstein-Barr vi...
P52544       218 LTEQkaffnieknietiekdlgeaiLNYGTIQSVV-TEIKKIFKQQRsae------------------------------ 266 Human herpesvir...
P30674       220 ITIKkvlvqldmdaqaveqdmgdiaIRAPSVKGII-RAIKSLASFSpas------------------------------- 267 Murine cytomega...
F5HC79       220 IAVHrpssqsdvniqtveqdlldltTRIPHLAGVL-SALKSLFSSSsay------------------------------- 267 Human herpesvir...
Q77MS2       235 ITKQinirvn----------sddmvTHLPHATYVPDDKRTTAQTALD--------------------------VIQSTMR 278 Marek's disease...
P09284       228 VTKQvrvnvd----------vddiiRCLPYIPDVPDIKRQSAVEALRt------------------------lQTKTVVN 273 Human herpesvir...
P89451       230 VTQQaqvrld----------anelrRYLPHAAGLSDAARARALCVLDqal---------------------arTAAGGGA 278 Human herpesvir...
P24911       209 VCKQ---------------------LNPEPIQGMFENELLQRHIIVE----------------------------SNKQK 239 Herpesvirus sai...
Q2HRD2       211 ICTP---------------------ACGEPVRGLFENELKQLGLQTP---------------------------ESIPTT 242 Human herpesvir...
Q66612       215 VCRQ---------------------VPSDPVIGVFENELRHLGADARaagragggreserrgredaddeeddeEEPRDGQ 273 Equid herpesvir...
Q6UDK3       330 APAgddradleHEARASRILDSYDVFTEAPGPVYRLSELRYWLASGKAagakTRGScahathqatvlqkldtdLSAMFAR 409 Psittacid herpe...
O36361       247 HEA--------VLQESLAYLKAHTIFNNTPKQVLELSNLLYWNSGQNQ----PSDSgvk-----------cseLSKIWSR 303 Alcelaphine her...
YP_001129509 240 EEGavpgpgrpEAEGATRALDTYNVFSTVPPEVAELSELLYWNSGGHAigatGQGEggg-----------hsrLSALFAR 308 Epstein-Barr vi...
P52544       267 ---------slHVSDAEKTLKKYNIFSKVPDVIYSLSEFTYWSKISETivrn-----------------vaitLQQLNSC 320 Human herpesvir...
P30674       268 ---------yaYINDAEEALRGYNLFSEIPDRIYSLSDYTYWSKTSEAivrh-----------------vgitMRQLNVS 321 Murine cytomega...
F5HC79       268 ---------hsYIQEAEEALREYNLFTDIPERIYSLSDFTYWSRTSEVivkr-----------------vgitIQQLNVY 321 Human herpesvir...
Q77MS2       279 DTTtendsnisVSKAAAAALDAHNVFLPASGDLYAISELQFWIASSGRklhqPRGNtves---------fadnLEALVSK 349 Marek's disease...
P09284       274 PMGakndtfdqTYEIASTMLDSYNVFKPAPRCMYAISELKFWLTSNSTegpqRtldv------------fvdnLDVLNEH 341 Human herpesvir...
P89451       279 RAGpppadsssVREEADALLEAHDVFQATTPGLYAISELRFWLASGDRarhstm-------------dafadnLNALAQR 345 Human herpesvir...
P24911       240 EQNqtcsidnqIRDASLSKLNQHTIFENISAPVLELSNLIYWSSGAHK----KCANven-----------tseMAKLLSY 304 Herpesvirus sai...
Q2HRD2       243 PCQsrvrqddeIRQSSLMAVGDHHIFGEVTRSVLEISNLIYWSSGHSDa---TCDGdrd-----------cshLASLFTH 308 Human herpesvir...
Q66612       274 GDAgdgaalrvLTESSLSVLAGHTIFEEEDGRLAEISNLVYWSSAADRggvgGTARats-----------sshMAKLFAH 342 Equid herpesvir...
Q6UDK3       410 AETFERECRSAERei-fGTSFAHFHRHVASKiasvrgvggggeaLIDKLLAGSPATAPEAEIETLISSCYSHHMSLPLFS 488 Psittacid herpe...
O36361       304 ENELQKYRPKLNN----GEPPGHFFDLHSPQ-------------GTELLFCGGIFSSTHDTITALKQDCSNTFMKQTRLT 366 Alcelaphine her...
YP_001129509 309 ERRLALVRRACEEal-aGARLTHLFDAVAPG-------------ATERLFCGGVYSSSGDAVEALKADCAAAFTAHPQYR 374 Epstein-Barr vi...
P52544       321 HTLYKQLQNDVSLyl-yGEVSEDFLALSENLl-----------tHDERLYVGSIYVSPSRLIDLVTGLSIKNLEESPIFK 388 Human herpesvir...
P30674       322 HSLWKTLRTELSRyh-yGEDLEDVFTLGEGRf-----------gGDERIYVGSIFAAPGKVVDMITSMSIKSFENNPLFN 389 Murine cytomega...
F5HC79       322 HQLCRALMNGISRhl-yGEDVEDIFVLGEKAl-----------dGEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFN 389 Human herpesvir...
Q77MS2       350 ERLFDLRTSIVETav-fDRRMDHFERVFAQEieh--------mnAADRLLLGGRAAAPDDIIEALIKACYDHHMSAPLLK 420 Marek's disease...
P09284       342 EKHAELTAVTVELal-fGKTPIHFDRAFSEElgs--------ldAIDSILVGNRSSSPDSQIEALIKACYAHHLSSPLMR 412 Human herpesvir...
P89451       346 ELQQETAAVAVELal-fGRRAEHFDRAFGGHlaa--------ldMVDALIIGGQATSPDDQIEALIRACYDHHLTTPLLR 416 Human herpesvir...
P24911       305 EAKMQNYRKYI------CKNSTHFFDKYKPY-------------PIESIFCGGIFSSVDDTVKSLKSDCSLAFMKRANYQ 365 Herpesvirus sai...
Q2HRD2       309 EADMHKRRVDLAGclgeRGTPKHFFDCFRPD-------------SLETLFCGGLFSSVEDTIESLQKDCSSAFYQQVNYT 375 Human herpesvir...
Q66612       343 EARMHRSRAWLG-----RGAPSHFFDAHRPS-------------PLESLFCGGVFNSIDDTIAALQKDCSATFLKKSNYQ 404 Equid herpesvir...
Q6UDK3       489 RLGNPEKADTDALVEILKsyrdqtrpr-----------------adkaggraeDGAGDCDD-------------EGYPga 538 Psittacid herpe...
O36361       367 GVAKRQNELFMRLSNILY-----------------------------------GEEVPTKPkqtesalktcdqsDASK-- 409 Alcelaphine her...
YP_001129509 375 AILQKRNELYTRLNRAMQrl--------------------------------gRGEEEASRespevp-rpagarEPGP-- 419 Epstein-Barr vi...
P52544       389 RL-AEEDEVQHKIKSLLHdirdpqtte----------------------------------------------------- 414 Human herpesvir...
P30674       390 RL-HESNEIYAKIKSLIEeir-----------------------------gvgDGPAAGAArsraeaasgagagGEEGag 439 Murine cytomega...
F5HC79       390 KL-HESNEMYTKIKHILEeirrplpdgtggdgpegevihlrgreamsgtgttlMTASNSSNssthsqrnnggggRARGgg 468 Human herpesvir...
Q77MS2       421 RLLYPDEAAHDALKTVLErvss----------------------------hciGNDIQCQD----------------Gdg 456 Marek's disease...
P09284       413 HISNPSHDNEAALRQLLErv-------------------------------------gCEDdltkeasdsatasECDLnd 455 Human herpesvir...
P89451       417 RLVSPEQCDEEALRRVLArlga----------------------------ggaTGGAEEEEpraaaeeggrrrgAGTPas 468 Human herpesvir...
P24911       366 QLIKKQNELFVRLNKILQ------------------------------------GEDTVSHaasavp-lsdkatIVNP-- 406 Herpesvirus sai...
Q2HRD2       376 TALQKQNEFYVRLSKLLAagq------------------------------lnLGKCSTEScpsearrqlvggdKPE--- 422 Human herpesvir...
Q66612       405 TLIQQQNELYVRLNEVLNgag-----------------------------rdeGGAKGAEAiadaeplkpdggaSCDP-- 453 Equid herpesvir...
Q6UDK3       539 adatrrgqrdwigrvrvdtaavadehedkvkkllD------RAERDLTTRRKNYAERLSARSFSNLDRCVKNQRAELEKL 612 Psittacid herpe...
O36361       410 ----------------------------------N------QVLQEAELRKEAYLNKLSKEGFRKLQACLSTHEEMLNSQ 449 Alcelaphine her...
YP_001129509 420 ----------------------------------S------GALSDALKRKEQYLRQVATEGLAKLQSCLAQQSETLTET 459 Epstein-Barr vi...
P52544       415 --------------------------tpgrlntiNcmlqthNLQQEVLARKKAYFQKVSESGYNRVMACIREQESLINKV 468 Human herpesvir...
P30674       440 aaagrgntggdeg-------agtttamssalecgDpllrvhDVNKEVNVRKRAYLKKVSEMGYNKVMACIRNQEHLVTKL 512 Murine cytomega...
F5HC79       469 kkavgggangqdgdgsenglrvrncdehealdlvDarsrihNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKL 548 Human herpesvir...
Q77MS2       457 tcgermnetghfrtndsfamsttslghdewlemvK------SASSDVARRRKMYAERLTKKSLASLDKCITEQRHELEKM 530 Marek's disease...
P09284       456 dssitfa-------------------vhgwenllS------KAKIDAAERKRVYLEHLSKRSLTSLGRCIREQRQELEKT 510 Human herpesvir...
P89451       469 edgergpepg-------------aqgpeswgdiaT------RAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKM 529 Human herpesvir...
P24911       407 ----------------------------------D------QVLHDAHARKDAYLQKVTKDGLKSLYTCLETQGAVLSNT 446 Herpesvirus sai...
Q2HRD2       423 -----------------------------------------EVLRDAKHRQELYLQKVARDGFKKLSDCIRHQGHILSQT 461 Human herpesvir...
Q66612       454 ----------------------------------R------DVLSDARVRRDLYLKKLTRDGLRRLTDCIETHGRVLSDT 493 Equid herpesvir...
Q6UDK3       613 LRVNVYGAALPAMYVELKNGFLARQAFMKAVTSDESQhirrcrlaREDVEGYEQHQYVRSALMRTSLDPAALPHLASRFY 692 Psittacid herpe...
O36361       450 LSLKIWGSVVYKQSATLLNHFLFRQSWVTQASLPPSV--------NGSPEQFENSKFIKSSLYVKSLSREYLSTLRLHFF 521 Alcelaphine her...
YP_001129509 460 LCLRVWGDVVYWELARMRNHFLYRRAFVSGPWEDRRA---------GEGAAFENSKYIKTHLFTQTLSSEHLHALTHSLY 530 Epstein-Barr vi...
P52544       469 VSVNVYGNFIFEALSKIMNGFVLRKMYLdg-------------siRVDSCTYDEHLYIKNNLMPKKLPLELLPDLSEIMY 535 Human herpesvir...
P30674       513 VNVNLVGTVCLEAVSKIMNGFLSRQRSI----TEAETyp-----dvAESLGYDEHLYVINNLVHKRLPSELLPQLGQQIY 583 Murine cytomega...
F5HC79       549 IDVNLVGPLCLDFISKLMNGFLYRSQYH----QDQDVvd------vGNQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIY 618 Human herpesvir...
Q77MS2       531 LRVNVYGEVLIDSYTALFNGFRSRKRLLEAVKNCCANii----dnRNSDDAFDAHRFMQTSLLKHRIDPAMLPSLTHKFF 606 Marek's disease...
P09284       511 LRVNVYGEALLQTFVSMQNGFGARNVFL-AKVSQAGCii----dnRIQEAAFDAHRFIRNTLVRHTVDAAMLPALTHKFF 585 Human herpesvir...
P89451       530 LRVSVHGEVLPATFAAVANGFAARARFC-ALTAGAGTvi----dnRAAPGVFDAHRFMRASLLRHQVDPALLPSITHRFF 604 Human herpesvir...
P24911       447 LSMRVWGGAVYDEIVKLKNHFLFRDQFISLDWIHCET---------DSVTGFENSKYIKNLIYSQKLSSEHISSLTLQFY 517 Herpesvirus sai...
Q2HRD2       462 LGLRLWGSVIYNEASALQNHFLHRAQFISLPWQDLTV---------DCPTRFENSKYIKNSLYCQRLGREHVEILTLEFY 532 Human herpesvir...
Q66612       494 LSLRVWGSALYASAARLVNHFLFRRQFVGLGWADLTA---------GGEAAFENSKYIKNALHGQRLNREHLDSIVVHFY 564 Equid herpesvir...
Q6UDK3       693 ELVSGPMfRRHVERFPQPPNTSLYFTVENVGLLPHLKEELASF-TR-TYAHAEWMVSEFREFYDFSGiSGVSETQRAA 768 Psittacid herpesv...
O36361       522 ALITGPL-TTQEGLFPSPPNVQLAHCLEAAHFMPHQKMLLNEMiKP-TMEPQDWICSNFNEFYTIHE-TDLNGVQYEC 596 Alcelaphine herpe...
YP_001129509 531 TFITGPL-AEESGLFPPPSNVALARCCDAAGTLPHQKAFLTSLiWP-GIEPSDWIETSFNSFYSVPG-GSLASSQQil 605 Epstein-Barr viru...
P52544       536 TLLTGPLsDFHKSAYPLPANISMAYGCDHAEMLPHMKEDLARCiEG-TIHPSVWMVCEYNEFFNFSGvTDVNDMQKKM 612 Human herpesvirus...
P30674       584 RFINGPMfTHYLDRHPLPYNVNMAYACDNAGILPHVKEDLVRCaDG-TVVPSDWMTVGYMGFFRFADiRELNDLQKMV 660 Murine cytomegalo...
F5HC79       619 ELCNGPLfTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCaEG-TVYPSEWMVVKYMGFFNFSDcQDLNVLQKEM 695 Human herpesvirus...
Q77MS2       607 QLVNGPMfSHDRHRFAQPSNTALYFSVENVGLLPHLKEEMARFmFH-SSRKTDWTVSKFRGFYDFSTiDNVTAAHRMA 683 Marek's disease h...
P09284       586 ELVNGPLfNHDEHRFAQPPNTALFFTVENVGLFPHLKEELAKF-MG-GVVGSNWLLSPFRGFYCFSGvEGVTFAQRLA 661 Human herpesvirus...
P89451       605 ELVNGPLfDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFiMGaGGSGADWAVSEFQKFYCFDGvSGITPTQRAA 682 Human herpesvirus...
P24911       518 KLITGPL-SQNVSFFPLPSNIALAHCLDAAGALPHHKLLLTEMiWP-SIEPKDWVSQTYNKFYTITS-TDLNSIQKEA 592 Herpesvirus saimi...
Q2HRD2       533 KLITGPL-SKRHTLFPSPPNVTLAQCFEAAGMLPHQKMMVSEMiWP-SIEPKDWIEPNFNQFYSFEN-QDINHLQKRA 607 Human herpesvirus...
Q66612       565 RLITGPL-SLQNSHFPVPDNVALAYCLDAAGAMPHQKLVITEMiWP-GIESKDWIDCNFNSFYSIET-GDLNLTQKKt 639 Equid herpesvirus...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap