Conserved Protein Domain Family
PRTP

?
pfam01366: PRTP 
Herpesvirus processing and transport protein
The members of this family are associate with capsid intermediates during packaging of the virus.
Statistics
?
PSSM-Id: 279677
View PSSM: pfam01366
Aligned: 12 rows
Threshold Bit Score: 720.739
Threshold Setting Gi: 81920565
Created: 13-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81987381   40 TRRLLAVAGQLQTLLFQIELLKRCDPEVLVKralrAKIKHNALMVLYLHSRLAGDLAAQAAHRLTVGIYCLWMWLRRACS 119
gi 81920565    2 GQYLAALYSQIYGLCLDVSLVEFCKPTSLCL----TKIADACNKVHKIHEYVSASLLQQNSLEACALSLELSHLLENLKT 77
gi 123811623   2 SGLLAAAYSQVYALAVELSVCARLDPRSLDV----AAVVRNAGLLAELEAILLPRLRRQNDRACSALSLELVHLLENSRE 77
gi 34395969    4 LQSLCVLCARLNECALDLECLKFCDPVIVLSd--mANFKKNGIVILHLYQTFFEGIKEQNLLCASALTVYMQVLLKAMYE 81
gi 266328      6 LQKLCVVCSKCNECAMDVECLKYCDPNIVSMd--sTAFRRNGVMVIHLYRTLYPALVSQNAVQTSVLTLYMEMLLQGLYD 83
gi 395455102   6 LQKLCVVCSKCNEYAMELECLKYCDPNVLLAe--sTPFKRNAAAIVYLYRKIYPEVVAQNRTQSSLLTLYLEMLLKALHE 83
gi 327488366  21 TQKLFAIWGQIQSYLFQVELLKRCDPTVGVRm--iNRLKLNVLMIYYLEKKMVPALKEQREMNLTPLTYGLWLALRRAKL 98
gi 124095      6 NRTLLVLLGQVYTYIFQVELLRRCDPRVACRf--lYRLAANCLTVRYLLKLFLRGFNTQLKFGNTPTVCALHWALCYVKG 83
gi 82013511   16 RQKLLALLGQVQTYVFQLELLRRCDPQIGLGk--lAQLKLNALQVRVLRRHLRPGLEAQAAAFLTPLSVTLELLLEYAWR 93
gi 124093      2 AQHLAAVYSQIYGLTLDVSILTFVDPAHINW----KTVTKNTEKINKIYLQIMPLLHNQNNIESTSLSVELQHLLHNLKI 77
gi 123831268   2 AKELAAVYADVSALAMDLCLLSYADPATLDT----KSLALTTGKFQSLHGTLLPLLRRQNAHECSGLSLELEHLLENVAD 77
gi 82013647    2 ARELAAVYAQVFDLAAEVSLLGYCDPSSIDK----RCVMANSNKVFKLCESLLPCLRLQNDTECSPLSLELQHLLQNTRE 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81987381  120 EAAALANEIdty---------atyRDKDRFFSATMn-lSPggtCRLHSLV----------GLSLYGrTQDVTRELGLIND 179
gi 81920565   78 RLFFIYHAL---------------LDNPTYFSKLHssvGL---CDLHKKL----------NVQFYN-ECGIEVNLTLIND 128
gi 123811623  78 As-----------------------------------aALlapGRKGTRVpplrtpsvaySVEFYG-GHKVDVSLCLIND 121
gi 34395969   82 QVLLLDAALesf---------mvdQDRKKYFEKVL----ClkrCAEHLSI----------NISLNN-GVEFIVQLSTLND 137
gi 266328     84 TMREIDMALtdf---------gthRDRQRYYRRVL----KldsCNRHESI----------TITFAP-ELALTIDLATLND 139
gi 395455102  84 DTALLDRALmay---------srqPDRAAFYRTVL----RldrCDRHHTV----------ELQFTD-NVRFSVSLATLND 139
gi 327488366  99 EGELLLDALcef---------kdgGNLRDFFRKSM---SMcgdCPYHSTV----------ELDTYG--GKVSTEIKFLHD 154
gi 124095     84 EGERLFELLqhfktrfvygetkdsNCIKDYFVSAF----NlktCQYHHEL----------SLTTYG--GYVSSEIQFLHD 147
gi 82013511   94 EGERLLGHLetf---------attGDVSAFFTETM---GLarpCPYHQQI----------RLQTYG--GDVRMELCFLHD 149
gi 124093     78 VLETFSAHLsdy---------------nmYFENIH---SLsapCSRHKSI----------VFQFYN-NCCVSVKMCIIND 128
gi 123831268  78 ALTTLGVCTsr------------kLSPEEHFSLLH----LditCNKHRSV----------RFNFYG-NWALELKLSLIND 130
gi 82013647   78 ALGVLTDLLsg------------dPSRSEYFEALHpsrPLegpCKRHARV----------RVPFYG-GAEKTVSLSLLND 134
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81987381  180 AENLLKQINYCHLIVSTESAEAALVGVDEFLTATVGGGMVASPETYDHTQPCCICLDELSVTANQGDTIYKRLGYSVCDH 259
gi 81920565  129 IERFLSRLNCVFYCLSSSSALLALKEALTFLGQLRGISPVPRTDIYITSSSCLECVLETSVVPNQGETLNELLLNHNCHH 208
gi 123811623 122 IEILMKRINSVFYCMSHTMGLESLERALDLLGRFRGVSPIPDPRLYITSVPCWRCVGELMVLPNHGNPSTAEGTHVSCNH 201
gi 34395969  138 IEQLISKINSVYALLLPQEGLQICGKIIDLLTIMCGACMVAKPESYLETKTCMKCYEELTLTPNQGKSLRKRLHGKFCNH 217
gi 266328    140 VERLLCKINCVYGAVDASQGVAVCRRLLSLLARLCDICPVAGPEIYRETVTCFQCYEELMAVPNQGRSINRRMQGLLCDH 219
gi 395455102 140 IERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGTTCAQCYEELTIIPNQGRSLNKRLQGLLCNH 219
gi 327488366 155 VENVLKQLNYCHLILKADTVENFMVSLDNYLLKTLGSGSVVPPELYDPSQPCSVCFEELCVTANSGDSTHKRIVRKICDH 234
gi 124095    148 IENFLKQLNYCYIITSSREALNTLETVTRFMTDTIGSGLIPPVELFDPAHPCAICFEELCITANQGETLHRRLLGCICDH 227
gi 82013511  150 VENFLKQLNYCHLITPPSGATAALERVREFMVAAVGSGLIVPPELSDPSHPCAVCFEELCVTANQGATIARRLADRICNH 229
gi 124093    129 IEIFSKRLSSVFYCIRSCDALRGINHVIDFLGHLRGVSPIPLPDTYLSNIPCIYCLNEHMMLPNQGESLPSLMMCVNCKH 208
gi 123831268 131 VEIFFKRLSSVFYCIGSGSALEGLGEVLRFVGKLRGISPVPGPDLYVSNLPCLECLQEVCLTPNQGTSLQAMLPDTACSH 210
gi 82013647  135 VEVFFKRLNSVFYCLPAEGALEALGETVAFLGRLRGVSPIPPADAYVSSVPCASCFAEAAMLPNQGESVLSMLAAVNCNH 214
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81987381  260 LVKQvkvnvt----------pddvlRHMPFLNSVDANTLRGAIDKLRgssggevgggrrlagvvptgcraevgRSEQEDG 329
gi 81920565  209 LVER---------------------VPPEPIKGLFESELQNLGLKVHiat---------------------dtIEQSVGK 246
gi 123811623 202 LAVP---------------------VNPEPVSGLFENEVRQAGLGHLlea---------------------eeKARPGGP 239
gi 34395969  218 LTEQkaffnieknietiekdlgeaiLNYGTIQSVV-TEIKKIFKQQRsae------------------------------ 266
gi 266328    220 ITIKkvlvqldmdaqaveqdmgdiaIRAPSVKGII-RAIKSLASFSpas------------------------------- 267
gi 395455102 220 IAVHrpssqsdvniqtveqdlldltTRIPHLAGVL-SALKSLFSSSsay------------------------------- 267
gi 327488366 235 ITKQinirvn----------sddmvTHLPHATYVPDDKRTTAQTALD--------------------------VIQSTMR 278
gi 124095    228 VTKQvrvnvd----------vddiiRCLPYIPDVPDIKRQSAVEALRt------------------------lQTKTVVN 273
gi 82013511  230 VTQQaqvrld----------anelrRYLPHAAGLSDAARARALCVLDqal---------------------arTAAGGGA 278
gi 124093    209 VCKQ---------------------LNPEPIQGMFENELLQRHIIVE----------------------------SNKQK 239
gi 123831268 211 ICTP---------------------ACGEPVRGLFENELKQLGLQTP---------------------------ESIPTT 242
gi 82013647  215 VCRQ---------------------VPSDPVIGVFENELRHLGADARaagragggreserrgredaddeeddeEEPRDGQ 273
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81987381  330 APAgddradleHEARASRILDSYDVFTEAPGPVYRLSELRYWLASGKAagakTRGScahathqatvlqkldtdLSAMFAR 409
gi 81920565  247 HEA--------VLQESLAYLKAHTIFNNTPKQVLELSNLLYWNSGQNQ----PSDSgvk-----------cseLSKIWSR 303
gi 123811623 240 EEGavpgpgrpEAEGATRALDTYNVFSTVPPEVAELSELLYWNSGGHAigatGQGEggg-----------hsrLSALFAR 308
gi 34395969  267 ---------slHVSDAEKTLKKYNIFSKVPDVIYSLSEFTYWSKISETivrn-----------------vaitLQQLNSC 320
gi 266328    268 ---------yaYINDAEEALRGYNLFSEIPDRIYSLSDYTYWSKTSEAivrh-----------------vgitMRQLNVS 321
gi 395455102 268 ---------hsYIQEAEEALREYNLFTDIPERIYSLSDFTYWSRTSEVivkr-----------------vgitIQQLNVY 321
gi 327488366 279 DTTtendsnisVSKAAAAALDAHNVFLPASGDLYAISELQFWIASSGRklhqPRGNtves---------fadnLEALVSK 349
gi 124095    274 PMGakndtfdqTYEIASTMLDSYNVFKPAPRCMYAISELKFWLTSNSTegpqRtldv------------fvdnLDVLNEH 341
gi 82013511  279 RAGpppadsssVREEADALLEAHDVFQATTPGLYAISELRFWLASGDRarhstm-------------dafadnLNALAQR 345
gi 124093    240 EQNqtcsidnqIRDASLSKLNQHTIFENISAPVLELSNLIYWSSGAHK----KCANven-----------tseMAKLLSY 304
gi 123831268 243 PCQsrvrqddeIRQSSLMAVGDHHIFGEVTRSVLEISNLIYWSSGHSDa---TCDGdrd-----------cshLASLFTH 308
gi 82013647  274 GDAgdgaalrvLTESSLSVLAGHTIFEEEDGRLAEISNLVYWSSAADRggvgGTARats-----------sshMAKLFAH 342
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81987381  410 AETFERECRSAERei-fGTSFAHFHRHVASKiasvrgvggggeaLIDKLLAGSPATAPEAEIETLISSCYSHHMSLPLFS 488
gi 81920565  304 ENELQKYRPKLNN----GEPPGHFFDLHSPQ-------------GTELLFCGGIFSSTHDTITALKQDCSNTFMKQTRLT 366
gi 123811623 309 ERRLALVRRACEEal-aGARLTHLFDAVAPG-------------ATERLFCGGVYSSSGDAVEALKADCAAAFTAHPQYR 374
gi 34395969  321 HTLYKQLQNDVSLyl-yGEVSEDFLALSENLl-----------tHDERLYVGSIYVSPSRLIDLVTGLSIKNLEESPIFK 388
gi 266328    322 HSLWKTLRTELSRyh-yGEDLEDVFTLGEGRf-----------gGDERIYVGSIFAAPGKVVDMITSMSIKSFENNPLFN 389
gi 395455102 322 HQLCRALMNGISRhl-yGEDVEDIFVLGEKAl-----------dGEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFN 389
gi 327488366 350 ERLFDLRTSIVETav-fDRRMDHFERVFAQEieh--------mnAADRLLLGGRAAAPDDIIEALIKACYDHHMSAPLLK 420
gi 124095    342 EKHAELTAVTVELal-fGKTPIHFDRAFSEElgs--------ldAIDSILVGNRSSSPDSQIEALIKACYAHHLSSPLMR 412
gi 82013511  346 ELQQETAAVAVELal-fGRRAEHFDRAFGGHlaa--------ldMVDALIIGGQATSPDDQIEALIRACYDHHLTTPLLR 416
gi 124093    305 EAKMQNYRKYI------CKNSTHFFDKYKPY-------------PIESIFCGGIFSSVDDTVKSLKSDCSLAFMKRANYQ 365
gi 123831268 309 EADMHKRRVDLAGclgeRGTPKHFFDCFRPD-------------SLETLFCGGLFSSVEDTIESLQKDCSSAFYQQVNYT 375
gi 82013647  343 EARMHRSRAWLG-----RGAPSHFFDAHRPS-------------PLESLFCGGVFNSIDDTIAALQKDCSATFLKKSNYQ 404
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81987381  489 RLGNPEKADTDALVEILKsyrdqtrpr-----------------adkaggraeDGAGDCDD-------------EGYPga 538
gi 81920565  367 GVAKRQNELFMRLSNILY-----------------------------------GEEVPTKPkqtesalktcdqsDASK-- 409
gi 123811623 375 AILQKRNELYTRLNRAMQrl--------------------------------gRGEEEASRespevp-rpagarEPGP-- 419
gi 34395969  389 RL-AEEDEVQHKIKSLLHdirdpqtte----------------------------------------------------- 414
gi 266328    390 RL-HESNEIYAKIKSLIEeir-----------------------------gvgDGPAAGAArsraeaasgagagGEEGag 439
gi 395455102 390 KL-HESNEMYTKIKHILEeirrplpdgtggdgpegevihlrgreamsgtgttlMTASNSSNssthsqrnnggggRARGgg 468
gi 327488366 421 RLLYPDEAAHDALKTVLErvss----------------------------hciGNDIQCQD----------------Gdg 456
gi 124095    413 HISNPSHDNEAALRQLLErv-------------------------------------gCEDdltkeasdsatasECDLnd 455
gi 82013511  417 RLVSPEQCDEEALRRVLArlga----------------------------ggaTGGAEEEEpraaaeeggrrrgAGTPas 468
gi 124093    366 QLIKKQNELFVRLNKILQ------------------------------------GEDTVSHaasavp-lsdkatIVNP-- 406
gi 123831268 376 TALQKQNEFYVRLSKLLAagq------------------------------lnLGKCSTEScpsearrqlvggdKPE--- 422
gi 82013647  405 TLIQQQNELYVRLNEVLNgag-----------------------------rdeGGAKGAEAiadaeplkpdggaSCDP-- 453
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81987381  539 adatrrgqrdwigrvrvdtaavadehedkvkkllD------RAERDLTTRRKNYAERLSARSFSNLDRCVKNQRAELEKL 612
gi 81920565  410 ----------------------------------N------QVLQEAELRKEAYLNKLSKEGFRKLQACLSTHEEMLNSQ 449
gi 123811623 420 ----------------------------------S------GALSDALKRKEQYLRQVATEGLAKLQSCLAQQSETLTET 459
gi 34395969  415 --------------------------tpgrlntiNcmlqthNLQQEVLARKKAYFQKVSESGYNRVMACIREQESLINKV 468
gi 266328    440 aaagrgntggdeg-------agtttamssalecgDpllrvhDVNKEVNVRKRAYLKKVSEMGYNKVMACIRNQEHLVTKL 512
gi 395455102 469 kkavgggangqdgdgsenglrvrncdehealdlvDarsrihNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKL 548
gi 327488366 457 tcgermnetghfrtndsfamsttslghdewlemvK------SASSDVARRRKMYAERLTKKSLASLDKCITEQRHELEKM 530
gi 124095    456 dssitfa-------------------vhgwenllS------KAKIDAAERKRVYLEHLSKRSLTSLGRCIREQRQELEKT 510
gi 82013511  469 edgergpepg-------------aqgpeswgdiaT------RAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKM 529
gi 124093    407 ----------------------------------D------QVLHDAHARKDAYLQKVTKDGLKSLYTCLETQGAVLSNT 446
gi 123831268 423 -----------------------------------------EVLRDAKHRQELYLQKVARDGFKKLSDCIRHQGHILSQT 461
gi 82013647  454 ----------------------------------R------DVLSDARVRRDLYLKKLTRDGLRRLTDCIETHGRVLSDT 493
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81987381  613 LRVNVYGAALPAMYVELKNGFLARQAFMKAVTSDESQhirrcrlaREDVEGYEQHQYVRSALMRTSLDPAALPHLASRFY 692
gi 81920565  450 LSLKIWGSVVYKQSATLLNHFLFRQSWVTQASLPPSV--------NGSPEQFENSKFIKSSLYVKSLSREYLSTLRLHFF 521
gi 123811623 460 LCLRVWGDVVYWELARMRNHFLYRRAFVSGPWEDRRA---------GEGAAFENSKYIKTHLFTQTLSSEHLHALTHSLY 530
gi 34395969  469 VSVNVYGNFIFEALSKIMNGFVLRKMYLdg-------------siRVDSCTYDEHLYIKNNLMPKKLPLELLPDLSEIMY 535
gi 266328    513 VNVNLVGTVCLEAVSKIMNGFLSRQRSI----TEAETyp-----dvAESLGYDEHLYVINNLVHKRLPSELLPQLGQQIY 583
gi 395455102 549 IDVNLVGPLCLDFISKLMNGFLYRSQYH----QDQDVvd------vGNQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIY 618
gi 327488366 531 LRVNVYGEVLIDSYTALFNGFRSRKRLLEAVKNCCANii----dnRNSDDAFDAHRFMQTSLLKHRIDPAMLPSLTHKFF 606
gi 124095    511 LRVNVYGEALLQTFVSMQNGFGARNVFL-AKVSQAGCii----dnRIQEAAFDAHRFIRNTLVRHTVDAAMLPALTHKFF 585
gi 82013511  530 LRVSVHGEVLPATFAAVANGFAARARFC-ALTAGAGTvi----dnRAAPGVFDAHRFMRASLLRHQVDPALLPSITHRFF 604
gi 124093    447 LSMRVWGGAVYDEIVKLKNHFLFRDQFISLDWIHCET---------DSVTGFENSKYIKNLIYSQKLSSEHISSLTLQFY 517
gi 123831268 462 LGLRLWGSVIYNEASALQNHFLHRAQFISLPWQDLTV---------DCPTRFENSKYIKNSLYCQRLGREHVEILTLEFY 532
gi 82013647  494 LSLRVWGSALYASAARLVNHFLFRRQFVGLGWADLTA---------GGEAAFENSKYIKNALHGQRLNREHLDSIVVHFY 564
                        730       740       750       760       770       780       790
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 81987381  693 ELVSGPMfRRHVERFPQPPNTSLYFTVENVGLLPHLKEELASF-TR-TYAHAEWMVSEFREFYDFSGiSGVSETQRAA 768
gi 81920565  522 ALITGPL-TTQEGLFPSPPNVQLAHCLEAAHFMPHQKMLLNEMiKP-TMEPQDWICSNFNEFYTIHE-TDLNGVQYEC 596
gi 123811623 531 TFITGPL-AEESGLFPPPSNVALARCCDAAGTLPHQKAFLTSLiWP-GIEPSDWIETSFNSFYSVPG-GSLASSQQil 605
gi 34395969  536 TLLTGPLsDFHKSAYPLPANISMAYGCDHAEMLPHMKEDLARCiEG-TIHPSVWMVCEYNEFFNFSGvTDVNDMQKKM 612
gi 266328    584 RFINGPMfTHYLDRHPLPYNVNMAYACDNAGILPHVKEDLVRCaDG-TVVPSDWMTVGYMGFFRFADiRELNDLQKMV 660
gi 395455102 619 ELCNGPLfTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCaEG-TVYPSEWMVVKYMGFFNFSDcQDLNVLQKEM 695
gi 327488366 607 QLVNGPMfSHDRHRFAQPSNTALYFSVENVGLLPHLKEEMARFmFH-SSRKTDWTVSKFRGFYDFSTiDNVTAAHRMA 683
gi 124095    586 ELVNGPLfNHDEHRFAQPPNTALFFTVENVGLFPHLKEELAKF-MG-GVVGSNWLLSPFRGFYCFSGvEGVTFAQRLA 661
gi 82013511  605 ELVNGPLfDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFiMGaGGSGADWAVSEFQKFYCFDGvSGITPTQRAA 682
gi 124093    518 KLITGPL-SQNVSFFPLPSNIALAHCLDAAGALPHHKLLLTEMiWP-SIEPKDWVSQTYNKFYTITS-TDLNSIQKEA 592
gi 123831268 533 KLITGPL-SKRHTLFPSPPNVTLAQCFEAAGMLPHQKMMVSEMiWP-SIEPKDWIEPNFNQFYSFEN-QDINHLQKRA 607
gi 82013647  565 RLITGPL-SLQNSHFPVPDNVALAYCLDAAGAMPHQKLVITEMiWP-GIESKDWIDCNFNSFYSIET-GDLNLTQKKt 639
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap