Conserved Protein Domain Family
KRAB

?
pfam01352: KRAB 
KRAB box
The KRAB domain (or Kruppel-associated box) is present in about a third of zinc finger proteins containing C2H2 fingers. The KRAB domain is found to be involved in protein-protein interactions. The KRAB domain is generally encoded by two exons. The regions coded by the two exons are known as KRAB-A and KRAB-B. The A box plays an important role in repression by binding to corepressors, while the B box is thought to enhance this repression brought about by the A box. KRAB-containing proteins are thought to have critical functions in cell proliferation and differentiation, apoptosis and neoplastic transformation.
Statistics
?
PSSM-Id: 307490
View PSSM: pfam01352
Aligned: 560 rows
Threshold Bit Score: 45.8021
Threshold Setting Gi: 884853069
Created: 14-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 81908693    13 SVKFEDVSLTFTKEEWAQLDLQQKCLYREIMMENYNNMISVE 54
gi 612010451   14 LVTFVDVAVNLTQEEWHLLGPDQRSLYRDVMLENYGNIVSLG 55
gi 940732022   13 LLTFEDVAVFFTQEEWDYLDPAQRSLYKDVMMENYGNLVSLD 54
gi 640799048   14 LVTFEDVAVYFIRKEWKRLEPAQRDLYRDVMLENYGNVFSLD 55
gi 795125243   13 PVTFEDMAMYLTREEWRPLDPAQRDLYRDVMQENYGNVVSLD 54
gi 947235251   76 FVTFEDVAVHLTREEWGCLDSVQRDLYREVMLENYGNVVSLG 117
gi 821466263  157 SLMFKDVAVYLTQEEWGCLGPAQRGLYRDVMLENYGNLVSLG 198
gi 1022994770 100 SMMFEDIAVYLTQEEWGLLEPAQRNLYRNVMMENYRNIVSLG 141
gi 612037457   13 svMFEDMAMYLTPEEWGQADPTQRTLYRDMMLESYRNDISLD 54
gi 620963491   14 PVTFEDVAVYLTREEWKLLGPSQRDLYRDTMLENYRHVVSLG 55
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap