Conserved Protein Domain Family
KRAB

?
pfam01352: KRAB 
KRAB box
The KRAB domain (or Kruppel-associated box) is present in about a third of zinc finger proteins containing C2H2 fingers. The KRAB domain is found to be involved in protein-protein interactions. The KRAB domain is generally encoded by two exons. The regions coded by the two exons are known as KRAB-A and KRAB-B. The A box plays an important role in repression by binding to corepressors, while the B box is thought to enhance this repression brought about by the A box. KRAB-containing proteins are thought to have critical functions in cell proliferation and differentiation, apoptosis and neoplastic transformation.
Statistics
?
Aligned: 562 rows
Threshold Bit Score: 46.9544
Threshold Setting Gi: 52545948
Created: 23-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ELW47119     148 SVTFKDVAVDFSQEEWGRLGPGQRELYWDMMLENYRNLLSLG 189 Chinese tree shrew
ELK03384      18 SVSFKDVTIDFSWEEWQQLDFAQKSLYRDVMLENYFNLISVG 59  black flying fox
Q8C393        49 PVIFKDVAVYFSQKEWQLLEPAQKDLYKDVMLENYENLISVE 90  house mouse
XP_007489629 179 SVTFKDVAVMFSRKEWWHLQPTQMELYRDVMLENYRNMVSVG 220 gray short-tailed opossum
XP_007502894  14 SVTFQDVTIDFTQREWRQLTHAQKSLYREVMLENYENFVSVG 55  gray short-tailed opossum
XP_023355897  49 LVTFKDVSVDFSRSEWKQLKPAQKELYRDVMLENYKNLVSLG 90  Tasmanian devil
XP_012407354  44 LVSFRDVAIYFTQEEWSYLHSTQKHLYWDVMLENYENFISLG 85  Tasmanian devil
XP_026340318   4 GFQFKDVAIYFSQKEWECLHSAQKALYRDVMLENYNNLISLG 45  Ursus arctos horribilis
XP_026359846   7 SLSFGDVAVDFSQEEWQHLDPAQRTLYRDVMLENYHNFVSVG 48  Ursus arctos horribilis
XP_002930681  13 SVTFEEVAVDFSQEEWALLDAAQKILYRDVMLENYRNLASLG 54  giant panda
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap