5JPQ,3J38,3J80,3J60,3J20,5XXU,3J7A,5XYI,1YWX,6AZ1


Conserved Protein Domain Family
Ribosomal_S24e

?
pfam01282: Ribosomal_S24e 
Click on image for an interactive view with Cn3D
Ribosomal protein S24e
Statistics
?
Aligned: 183 rows
Threshold Bit Score: 47.8714
Threshold Setting Gi: 1304111837
Created: 24-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5JPQ_0              22 SLDVLHPDSPTASKEKIREELAKQLKVDARNVVVYGFSTQYGGGKSTGFALVYDNQQYLLKYEPNYRLRKVKILGEKPN 100 Chaetomium...
EDY37005            20 KFEVSHPKSKTPSRDEVRNLLAANLNADKNRVILDNMHTPFGSTTTTGFAKIYDDVENAKKIEPDYILIRNKLIEKKEE 98  Acidulipro...
EQB69649            20 KYTVEFEKNNTPSREVVKELIARNTNSNKELVIVDFNEQLTGLHVIKGYSKIYSKKEDAMLYEPDYELYRNGLKVKEEK 98  Thermoplas...
AGI85183            20 RFVVDHERESTPGRNAVAEELAKKYNTQRVCVVIDELAGEYGVGKTKGYAKIYANKKAALDCEEEHLLKRNGIAAEEKK 98  Candidatus...
licsiro:TALC_00506  20 HFLVDHDKESTPGRHAVAEELAKKFNTKRELVIIDSLDSMYGVGKTLGYAKIYKDVATAKKFENDYLLKRNGYQDKPAE 98  Thermoplas...
EQB65229            20 ryRAIHAKEKTPSREEARNQIAANLQVPKELVIIDYQKSKFGKNYTEGYAKIYKTKEEAMALEPDFLLIRNGLKSKEGD 98  Thermoplas...
jgi:Mpet_0095       20 DFVLTYDG-ATPSRKEILGKLCALRNVSPELCVLGSMKTEFGKQEIAGQARVYQDAEVLKSTELNHVIENSTFTAEAAE 97  Methanolac...
jgi:Memar_2245      20 EFTLTFDG-ATPSRKSIQEKLAALQNKDENLLVLDLERTRFGKMELLGRARIYDDEETKKSTEREYLLKRGEPKAESea 97  Methanocul...
B8GFC3              20 RFILTYDG-ATPSRKEIRGKLCALNNINENLVVLDSLRTGYGRMQLDGFMRIYDTEEGRQRTERSYLLNRGEPKKEEEe 97  Methanosph...
jgi:Metfor_2871     20 QFTLKYDG-ATPSRMQIIGKLCALLNVKEHQVTLDTLHSSFGKTELTGSARVYESEESRNKTERPHLAARGMPKPKeea 97  Methanoreg...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap