2XZM,3J38,3J80,3J60,3J20,3J7A,1YWX,3ZEY


Conserved Protein Domain Family
Ribosomal_S24e

?
pfam01282: Ribosomal_S24e 
Click on image for an interactive view with Cn3D
Ribosomal protein S24e
Statistics
?
PSSM-Id: 334470
View PSSM: pfam01282
Aligned: 169 rows
Threshold Bit Score: 48.634
Threshold Setting Gi: 154345982
Created: 18-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
2XZM_P        22 SLDVLHPDSPTASKEKIREELAKQLKVDARNVVVYGFSTQYGGGKSTGFALVYDNQQYLLKYEPNYRLRKVKILGEKPN 100
gi 521284338  20 KFKAIHVGESTPNRDAIKEALASNFSAPKDNIIVTRMNSEYGKCSTDGYAKIYDSADIAKTHERNYLLVRNGLAEKKVR 98
gi 530553829  20 ryRAIHAKEKTPSREEARNQIAANLQVPKELVIIDYQKSKFGKNYTEGYAKIYKTKEEAMALEPDFLLIRNGLKSKEGD 98
gi 505304922  20 HFLVDHDKESTPGRHAVAEELAKKFNTKRELVIIDSLDSMYGVGKTLGYAKIYKDVATAKKFENDYLLKRNGYQDKPAE 98
gi 546146642  20 KYTVEFEKNNTPSREVVKELIARNTNSNKELVIVDFNEQLTGLHVIKGYSKIYSKKEDAMLYEPDYELYRNGLKVKEEK 98
gi 495357791  20 KFEVSHPKSKTPSRDEVRNLLAANLNADKNRVILDNMHTPFGSTTTTGFAKIYDDVENAKKIEPDYILIRNKLIEKKEE 98
gi 505099713  20 QFTLKYDG-ATPSRMQIIGKLCALLNVKEHQVTLDTLHSSFGKTELTGSARVYESEESRNKTERPHLAARGMPKPKeea 97
gi 503093229  20 DFVLTYDG-ATPSRKEILGKLCALRNVSPELCVLGSMKTEFGKQEIAGQARVYQDAEVLKSTELNHVIENSTFTAEAAE 97
gi 490178446  20 DFVINYEG-ATPSRKEILGKLCAMRNVPVTNCVVDSLKSEFGKQEIIAKARIYTDAEALKSTELDYLVSRNSAAPEAEA 97
gi 500158359  20 AFTASYDG-ATPARSDIGAKIAAMQNTPVENLILSPLKGRFGTRAVTGVARIYDTPEALKATEREFLIARGQPKAEKEe 97
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap