3J39,1S72,3J21,1VX7


Conserved Protein Domain Family
Ribosomal_L19e

?
pfam01280: Ribosomal_L19e 
Click on image for an interactive view with Cn3D
Ribosomal protein L19e
Statistics
?
Aligned: 142 rows
Threshold Bit Score: 129.512
Threshold Setting Gi: 157919438
Created: 24-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3J39_R               3 SLKLQKRLAASVLRCGKKKVWLDPNEINEIANTNSRQNIRKLIKDGLIIKKPVVVHSRYRVRKNTEARRKGRHCGFGKRK 82  fruit fly
EQB64735             3 TLSPQKRMAASIMKSGKSRVWMDTKSIDDIAEAVTRDDVRKLIKRNVIQKKPAKGNSRSRFKVAKAQRNKGRRKGQGSRK 82  Thermopla...
EQB71657             2 KLNTARRLAADEFKSGLSRVWVDTNSIDQVMEAASRQDIRDLIRRNVIQVKQKKGNSNARLKKRVVQRSKERRRGPGSIK 81  Thermopla...
EQB66911             2 RMETAKRIAADEFKSGVSRVWVDTNSVSEVLECATRDDIRQLIRRNVIQLKQKKGNSNWRLKKRIAQISKERRRGPGSIR 81  Thermopla...
EQB68270             2 RVETAKRIAADEYKSGVSRIWVDMDSLTLVQEAATREDVRNLMEKHVIQAKPKKGNSNARFKKRLKQLSKERRRGPGSVR 81  Thermopla...
Q9HIS5               2 rSDSVKRIVADIKGVGTSRVYIDTNKVDRVMEAATRQDVIALMKQDVIKIKQKKGISNGRLKKRIKQLSKDRRRGPGSLR 81  Thermopla...
Q6L1A9               2 KVQSVKQIAADEMKVGVSRVWIDTNSIDQVLDATSREDVRKLIDLHIIQKKQKKGNSNYRLKKRIEQLAKGRRRGEGSVR 81  Picrophil...
jgi:Aboo_1503        2 DVKFQRRLAASILKCGEERVWMDPNALDEIKEAVTREDIKMLIKRGLIKRKKIKGTSRVRANYIKMQKEKGRRKGPGSRK 81  Acidulipr...
AGN25832             2 DLKNQKRMAADILGCGVNRVWIDPNKIEELSDAITRADIRTAIESGTIKALPVRGNSRGRIRHNLAQRKKGRQRGPGSRK 81  Candidatu...
licsiro:TALC_01316   3 DLRNQKRLAADILKCGENRVWIDPEHIEEVQDCITRGDVRTAIDSGLIKAKPKNGTSRGRIRHAAKQKASGKRKGPGSRK 82  Thermopla...
3J39_R              83 GTANARMPTKLLWMQRQRVLRRLLKKYRDSKKIDRHLYHDLYMKCKGNVFKNKRVLMEYIHKK 145 fruit fly
EQB64735            83 GTKNARDPRKRKWVRSIRSMRNALKEMRESGKITRKDYRVFYKKIKGGALRSKNALLLHMREE 145 Thermoplasmatales archaeon...
EQB71657            82 GTKYARFPRKDRWIKTIRALRDELRTMKKDNRIDAKTFRKFYVQVKGGNIHSRAQLVQHMKSS 144 Thermoplasmatales archaeon...
EQB66911            82 GTKYARFPRKARWIKTIRPLRDELRTLKTSGRIDPKVYRKYYRVIKGGSVRSRAQLRTQLKAA 144 Thermoplasmatales archaeon...
EQB68270            82 GTRNARFPRKRRWIKTIRALRDELRTLKSENKIDAKTYRKYYRIVKGGTIKSRAQLRSQIRLa 144 Thermoplasmatales archaeon...
Q9HIS5              82 GTKYARYPRKDRWIDTIRALRDELRTLKSEGKITKETYRKYYRFIKSGSIRSRSQLLSHLKSA 144 Thermoplasma acidophilum
Q6L1A9              82 GTKYARFPRKRRWISRIRALRRELRELKTNNKIDKKTYRRYYRIIKSGSFVSRAQLRNHIQAA 144 Picrophilus torridus
jgi:Aboo_1503       82 GKKYARYPRKQRWMKTIRPIRATLKDLRDSGKIDRHAYRRFYRLAKGGTFKSRSHLLMHLKAE 144 Aciduliprofundum boonei T469
AGN25832            82 GRSGARSPRKRRWIQTIRPIRAELKELRDTGKISKQTYRLFYRKAKGGQFKSRNHLLSHMKAS 144 Candidatus Methanomassilii...
licsiro:TALC_01316  83 GTANARVPEKRQWIARIRPIRDELKQLRADGKITPSIYRLYYRKAKGGSYTSRRNLKQHMIAD 145 Thermoplasmatales archaeon...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap