4UQF,4DU6


Conserved Protein Domain Family
GTP_cyclohydroI

?
pfam01227: GTP_cyclohydroI 
Click on image for an interactive view with Cn3D
GTP cyclohydrolase I
This family includes GTP cyclohydrolase enzymes and a family of related bacterial proteins.
Statistics
?
Aligned: 79 rows
Threshold Bit Score: 195.432
Threshold Setting Gi: 123338676
Created: 24-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4UQF_A         22 IADAVKVILEAVGENPDREGLID-TPMRVARMY-EEVFAGLKKDP--Sv-HF--DTIFE----EQHEEL--VLVKDIRFS 88  Listeria monoc...
Q2Y6B3          9 GIGDWQRLLRSLGEDPSRQGLRE-TPERVTRAW-AHWTRGYKQDP--Aa-IL--KTFADg--gESYDEL--IVVRQIPVY 77  Nitrosospira m...
jgi:Acel_1665  37 AERAAAAFLHALGIDLDSEVMAQ-TPKRMARGF-AELLEPREFTLt----TF--PNTER------YDEM--VAARHIPFV 100 Acidothermus c...
jgi:Noca_3354  40 AESAASDLLRALGLDIETDEMVE-TPRRLVAAY-HELLTGPDVDLt----TF--PNTEG------YDEL--VLVANIPVR 103 Nocardioides s...
Q63KW5         31 FEAAVRALLEASGIEIDSAHTGR-TAQRVRELWqRRLLDGYEVDPa---qAL--GAGFD----DPREDM--VIVRSIAVH 98  Burkholderia p...
Q0RM61          6 AVAAVEELLAALEVNEA-DHTAD-TPRRVVRAW-QETLAGYQADPr---rHL--ARTFTa-----PDDPglVVVAGLHLV 72  Frankia alni A...
Q8I5H7        206 ISKHIYKIL-NISKLPKCDILKR-TNRRYAETF-LYLTNGYNLDIeqIikRSlyKRMYK------NNSI--IKVTGIHIY 274 Plasmodium fal...
Q5V5Y0         27 ARRGARLLLEAAGRDPDSAGLSDtWSRRVPDMF-ETLTEGARSESk----PI--MRTFD----AETDGL--IVKTGIPLH 93  Haloarcula mar...
Q6ACQ1          9 IEAAVAEILAAVGEDPSRPGLSA-TPSRVADAY-AEFFAGLGRDA--Ea-EL--GEPVPleqgQA--ET--VILREISFR 77  Leifsonia xyli...
Q6ME26         38 IAEHFKAIMETLELDVEDESLAR-TPERVAKMYvNEIFSGLDEENfpEisFF--KDEIH------HEHKanMVFVKVGFT 108 Candidatus Pro...
4UQF_A         89 SMCEHHLVPFFGVAHVAYLPq-NGRVAGLSKLARVVDDVSRRPQLQERITTTVAEIMMEKLKPLGVMVIMEAEHMCMTIR 167 Listeria monoc...
Q2Y6B3         78 SHCEHHLAPFFGHATIGYLP--TGHIVGLSKLTRLVNCFAARLQVQERLTQQVAQSLLEHLQPKAVGVILRCRHMCMESR 155 Nitrosospira m...
jgi:Acel_1665 101 SLCEHHMFPFVGFATVGYLP--GDRILGLSKLARVVEHFARRPQVQERFTAQIARWLDEHLGPRGVGVIVDAEHLCMTIR 178 Acidothermus c...
jgi:Noca_3354 104 SVCEHHMLPFVGVAHVGYLP--DERILGLSKFARLVELVARRPQTQERLTTEVADHLTTHLQPRGVGVVIEAEHTCMSLR 181 Nocardioides s...
Q63KW5         99 GVCPHHLLPFRGVAHVAYLP--GGRLHGFGRIARMIDAISHRYTYQEWITHRIATALVTHGQARGAACLIEAEQLCLLMG 176 Burkholderia p...
Q0RM61         73 TTCAHHLLPIVGRATVAYRPapGAPVVGLSKLSRVVADYAARLQVQERLGWQIASAVQDCLAPVGAGCVITAVHGCMTVR 152 Frankia alni A...
Q8I5H7        275 SLCKHHLLPFEGTCDIEYIP--NKYIIGLSKFSRIVDVFSRRLQLQEDLTNDICNALKKYLKPLYIKVSIVAKHLCINMR 352 Plasmodium fal...
Q5V5Y0         94 SMCEHHMLPFRGVAHVAYRP--GDQMVGLSKLIRYVRWQSRQLTTQETLTRDIAAGLADELDAHGVVVELTATHMCEVMR 171 Haloarcula mar...
Q6ACQ1         78 SVCEHHLLPFIGVAHVAYLP--GEAVIGLGRIPRVIDTLAARPQVQERLTEQIADTFEAGAGARGVLVVLSAEHGCVTAR 155 Leifsonia xyli...
Q6ME26        109 SFCEHHFVPMSGFAYVAYIP--TNQLIGLSKIPRLVRYFAKRPQLQERLTAQIADSLALLLNTEHVAVSLTAIHSCVQAR 186 Candidatus Pro...
4UQF_A        168 GVNKPGTKTITSAVRGAFKNDDKLRSEVLAL 198 Listeria monocytogenes
Q2Y6B3        156 GIAVAGEETVTSAMLGDLKTNAAQRAEFLAL 186 Nitrosospira multiformis ATCC 25196
jgi:Acel_1665 179 GVRATGARTTTSALLGAFRDDPRVRAEFLDL 209 Acidothermus cellulolyticus 11B
jgi:Noca_3354 182 GVRAQGTRTVTSALRGTL-RDHAARAEFLSL 211 Nocardioides sp. JS614
Q63KW5        177 ENRRGDERVITQCYAGEFERDVQARNEFLRG 207 Burkholderia pseudomallei
Q0RM61        153 GVRQPTAVTTTAVWTGTWTPEHPDVEMVVAE 183 Frankia alni ACN14a
Q8I5H7        353 GVKEHDAKTITYASYKAEKENPTVHSLNIDS 383 Plasmodium falciparum 3D7
Q5V5Y0        172 GI-ETETKTTTREHVGTI--NEADRTQFRES 199 Haloarcula marismortui
Q6ACQ1        156 GPRQVAATTVTLAARGEF-AEPAARAELIAL 185 Leifsonia xyli subsp. xyli str. CTCB07
Q6ME26        187 GIQDECSHTITNVLRGQFGADGNLRREFFEG 217 Candidatus Protochlamydia amoebophila UWE25
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap