Conserved Protein Domain Family
ERG4_ERG24

?
pfam01222: ERG4_ERG24 
Ergosterol biosynthesis ERG4/ERG24 family
Statistics
?
PSSM-Id: 250456
View PSSM: pfam01222
Aligned: 5 rows
Threshold Bit Score: 615.603
Threshold Setting Gi: 1706692
Created: 14-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
pfam01222 is a member of the superfamily cl21511.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3123276   7 KSAPREFGG-AKGALAIMTGFP----CLMYYLWACSKFNDSQFIKPESFTIAGFQNFFRTLGHYIYVGa-----yPTRYA 76
gi 729438   17 RQQHYEFGG-PIGAFGITFGLPilvhVFNLFCNDISGCPAPSLLHPKSLDLAQLKREIGWPDNGVFGLf-----sWSATL 90
gi 416958    8 RTTEFEFGG-LIGALGISIGLP----VFTIILNQMIRPDYFIKGFFQNFDIVELWNGIKP--LRYYLG--------NREL 72
gi 125989  175 EEIYAEKKIfEAIKTPEKPSSK----TKELEFGGRFGTFMLMFFLPATVLYLVLMCKQDDPSLMNFPPlpaleslWETKV 250
gi 1706692  34 NEIEYEFGG-TTGVIGMLIGFP----LLMYYMWICAEFYHGKVALPKAG--ESWMHFIKHLYQLVLENg-----iPEKYD 101
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3123276  77 FLVFwsFCIVQAVMYLTLPGVRTQGLPLKhrNNERLPYLCNAIWS---FYTTIVILAVLHVTHVFPITTFIDMFGPLMSV 153
gi 729438   91 WTLG--YYALSLVQYRFLPGHHVEGTELS--TGGRLKYKLNAFNSamcTLAILAAGTIAQGAEFPVWTFISDNFAQIISA 166
gi 416958   73 WTVYclWYGILAVLDVILPGRVMKGVQLR--DGSKLSYKINGIAMsttLVLVLAIRWKLTDGQLPELQYLYENHVSLCII 150
gi 125989  251 FGVFllWFFFQALFYLLPIGKVVEGLPLS--NPRKLQYRINGFYA---FLLTAAAIGTLLYFQ-FELHYLYDHFVQFAVS 324
gi 1706692 102 WTIFltFWVFQIIFYYTLPGIWTKGQPLShlKGKQLPYFCNAMWT---LYVTTTLVLVLHFTNLFRLYVIIDRFGRIMTC 178
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3123276 154 AIITAFVCTFVLYTGTLLFGDRLFD---------KPHRLSGNPIYDAFMGACLNPRLGk----LLDFKMFFEVRIPWFIL 220
gi 729438  167 NILFAFALAIFVYVRSFDVKPGNKDmr-----qlAAGGVTGSLIYDFYIGRELNPRITlpligQVDIKEFMEMRPGLLGW 241
gi 416958  151 SILFSFFLATYCYVASFIPLIFKKNgngkrekilALGGNSGNIIYDWFIGRELNPRLG-----PLDIKMFSELRPGMLLW 225
gi 125989  325 AAAFSMALSIYLYIRSLKAPEed----------lAPGGNSGYLVYDFFTGHELNPRIG-----SFDLKYFCELRPGLIGW 389
gi 1706692 179 AIISGFAFSIILYLWTLFISH-------------DYHRMTGNHLYDFFMGAPLNPRWG-----ILDLKMFFEVRLPWFTL 240
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3123276 221 FFISVGAAVRQYETYGTVSPQVLFVCLG--HYLYANACSKGEQLIVPTWDMAYEKFGFMLIFWNMAGVPFTYSHCTLYLF 298
gi 729438  242 IILNCAFIAKQYRLYGYVTDSILFITAI--QAFYVFDGIYMEPAVLTTMDITTDGFGFMLSFGDVVWVPFMYSTQTRYLS 319
gi 416958  226 LLINLSCLHHHYLKTGKINDALVLVNFL--QGFYIFDGVLNEEGVLTMMDITTDGFGFMLAFGDLSLVPFTYSLQARYLS 303
gi 125989  390 VVINLAMLLAEMKIHNQSMPSLSMILVNsfQLLYVVDALWNEEAVLTTMDITHDGFGFMLAFGDLVWVPFVYSLQAFYLV 469
gi 1706692 241 YFITLGACLKQWETYGYVTPQLGVVMLA--HWLYANACAKGEELIVPTWDMAYEKFGFMLIFWNIAGVPYTYCHCTLYLY 318
                      330       340       350       360       370       380       390       400
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3123276 299 SHdPSVYNWSTqyTTGIYVLLLCCYYIFDTCNGQKNHFRnqiygtevhrkTFPQLPWLIIknPTFIRCANGGTLLTSGWY 378
gi 729438  320 VH-PQQLGAFG--LIAVGAVLAAGYSIFRLSNSQKNNFR-----------TNPEDPSVKH--LTYLQTKTGSRLITSGWW 383
gi 416958  304 VS-PVELGWVk--VVGILAIMFLGFHIFHSANKQKSEFR---------------QGKLEN--LKSIQTKRGTKLLCDGWW 363
gi 125989  470 GH-PIAISWPv--AAAITILNCIGYYIFRSANSQKNNFR-----------RNPADPKLSY--LKVIPTATGKGLLVTGWW 533
gi 1706692 319 YHdPSEYHWSTlyNVSLYVVLLCAYYFFDTANAQKNAFRkqmsgdktgrkTFPFLPYQILknPKYMVTSNGSYLLIDGWY 398
                      410       420       430       440       450       460       470       480
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3123276 379 RYARKIHYTADFFQSLSWALITGFQ--------------------------------SPLPYFYPCFFFVVLVHRVSRDI 426
gi 729438  384 GIARHINYLGDWLQSWPYSLPTGIAgyqilsagsnapgaitmldgrevvqgeargwgIVFTYFYILYFAILLIHRDLRDD 463
gi 416958  364 AKSQHINYFGDWLISLSWCLATWFQ--------------------------------TPLTYYYSLYFATLLLHRQQRDE 411
gi 125989  534 GFVRHPNYLGDIIMALAWSLPCGFN--------------------------------HILPYFYVIYFICLLVHREARDE 581
gi 1706692 399 TLARKIHYTADWTQSLVWALSCGFN--------------------------------SVFPWFFPVFFLVVLIHRAFRDQ 446
                      490       500
               ....*....|....*....|....*...
gi 3123276 427 KKCKAKYGADFDEYCRICPY-LFIPYIF 453
gi 729438  464 EKCSKKYGDDWEKYKKLVKW-RIVPGIY 490
gi 416958  412 HKCRLKYGENWEEYERKVPY-KIIPYVY 438
gi 125989  582 HHCKKKYGLAWERYCQRVPYtHISLHLL 609
gi 1706692 447 AKCKRKYGKDWDEYCKHCPY-VFIPYVF 473
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap