4OBW


Conserved Protein Domain Family
Ubie_methyltran

?
pfam01209: Ubie_methyltran 
Click on image for an interactive view with Cn3D
ubiE/COQ5 methyltransferase family
Statistics
?
PSSM-Id: 334435
View PSSM: pfam01209
Aligned: 6 rows
Threshold Bit Score: 364.839
Threshold Setting Gi: 672885845
Created: 17-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4OBW_A        10 MSTKQKL---VGDVFSSVANRYDLMNDVMSLGIHRLWKDhFINKLDAGKRPNsttplNFIDVAGGSGDIAFGLLDHAESK 86  Saccharomyces c...
Q32A11        15 TVAKEQKadmVAHVFHSVASKYDVMNDLMSFGIHRLWKR-FTIDCSGVRRGQ-----TVLDLAGGTGDLTAKFSRLVGET 88  Shigella dysent...
P31113         2 QDSKEQR---VHGVFEKIYKNYDQMNSVISFQQHKKWRD-KTMRIMNVKEGA-----KALDVCCGTADWTIALAKAAGKS 72  Bacillus subtil...
P49016         8 TKVNEER---VQEIFNSISSDYDKMNAIISFKQHDLWRA-KTMKRMGDLTGL-----SILDLCCGTGDWTFDLSESVGPS 78  Lactococcus lac...
XP_001469347  11 MGLGDAY---VKKVFDSVATKYDMMNDVLSLGIHRIWKKhFVEDCVCPLPGS-----KFLDVAGGTGDIAFRITDSIRAR 82  Leishmania infa...
P49017        57 TVLKSTKqklVGDVFSSVANRYDLMNDVMSLGIHRLWKDhFINKLDAGKRPNsttplNFIDVAGGSGDIAFGLLDHAESK 136 Saccharomyces c...
4OBW_A        87 Fgdt--------esTMDIVDINPDMLKEGEKRAMEQGKYfkdpRVRFLVSNGEKLEEIDsDSKDIYTVSFGIRNFTDIQK 158 Saccharomyces c...
Q32A11        89 G-------------KVVLADINESMLKMGREKLRNIGVIg---NVEYVQANAEALPFPD-NTFDCITISFGLRNVTDKDK 151 Shigella dysent...
P31113        73 G-------------EIKGLDFSENMLSVGEQKVKDGGFS----QIELLHGNAMELPFDD-DTFDYVTIGFGLRNVPDYLT 134 Bacillus subtil...
P49016        79 G-------------KVIGLDFSENMLEIAKAKLKEEAKK----NIEFLQGNAMALPFEK-GSFDVVTIGYGLRNTPDYLT 140 Lactococcus lac...
XP_001469347  83 GqsfgivpktldgtKVVVCDINAMMLKEGQKRAEREGYM----DIDWVCASGEELPFED-GAFDSYTVSFGIRNFSDRPK 157 Leishmania infa...
P49017       137 Fgdt--------esTMDIVDINPDMLKEGEKRAMEQGKYfkdpRVRFLVSNGEKLEEIDsDSKDIYTVSFGIRNFTDIQK 208 Saccharomyces c...
4OBW_A       159 GLNTAYRVLKPGGIFYCLEFSKIENPLMDFAYQQWAK-VLPVMGSMIANDYDSYQYLVESIERFPDQETFKSMIEKAGFK 237 Saccharomyces c...
Q32A11       152 ALRSMYRVLKPGGRLLVLEFSKPIIEPLSKAYDAYSFhVLPRIGSLVANDADSYRYLAESIRMHPDQDTLKAMMQDAGFE 231 Shigella dysent...
P31113       135 VLKEMRRVVKPGGQVVCLETSQPEMFGFRQAYFMYFKyIMPFFGKLFAKSYKEYSWLQESARDFPGMKELAGLFEEAGLK 214 Bacillus subtil...
P49016       141 VLKEIFRVLKPGGRVVCIETSHPTLPIYKQAFELYFKnVMPFLGKVFAKSLKEYQWLQKSAEDFPDAKTLEELFRKAGFV 220 Lactococcus lac...
XP_001469347 158 ALREAFRVLKVGGALHVLEFSRVTCPLLSVPYELWSYgFMPQAGRMLADE-ESYRYLVDSIRAFPDQETFAQMIRDAGFG 236 Leishmania infa...
P49017       209 GLNTAYRVLKPGGIFYCLEFSKIENPLMDFAYQQWAK-VLPVMGSMIANDYDSYQYLVESIERFPDQETFKSMIEKAGFK 287 Saccharomyces c...
4OBW_A       238 SAGYESLTFGICAIHWGIK 256 Saccharomyces cerevisiae S288c
Q32A11       232 SVDYYNLTAGVVALHRGYK 250 Shigella dysenteriae Sd197
P31113       215 NVKYHSFTGGVAATHIGWK 233 Bacillus subtilis subsp. subtilis str. 168
P49016       221 AVEYQKHGGGAIASHFATK 239 Lactococcus lactis subsp. lactis Il1403
XP_001469347 237 YVRYENLTGGIACIHTGVK 255 Leishmania infantum JPCM5
P49017       288 SAGYESLTFGICAIHWGIK 306 Saccharomyces cerevisiae S288c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap