4OBW


Conserved Protein Domain Family
Ubie_methyltran

?
pfam01209: Ubie_methyltran 
Click on image for an interactive view with Cn3D
ubiE/COQ5 methyltransferase family
Statistics
?
PSSM-Id: 334435
View PSSM: pfam01209
Aligned: 6 rows
Threshold Bit Score: 364.839
Threshold Setting Gi: 672885845
Created: 17-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4OBW_A        10 MSTKQKL---VGDVFSSVANRYDLMNDVMSLGIHRLWKDhFINKLDAGKRPNsttplNFIDVAGGSGDIAFGLLDHAESK 86
gi 123561227  15 TVAKEQKadmVAHVFHSVASKYDVMNDLMSFGIHRLWKR-FTIDCSGVRRGQ-----TVLDLAGGTGDLTAKFSRLVGET 88
gi 399775      2 QDSKEQR---VHGVFEKIYKNYDQMNSVISFQQHKKWRD-KTMRIMNVKEGA-----KALDVCCGTADWTIALAKAAGKS 72
gi 1346175     8 TKVNEER---VQEIFNSISSDYDKMNAIISFKQHDLWRA-KTMKRMGDLTGL-----SILDLCCGTGDWTFDLSESVGPS 78
gi 146102488  11 MGLGDAY---VKKVFDSVATKYDMMNDVLSLGIHRIWKKhFVEDCVCPLPGS-----KFLDVAGGTGDIAFRITDSIRAR 82
gi 1353083    57 TVLKSTKqklVGDVFSSVANRYDLMNDVMSLGIHRLWKDhFINKLDAGKRPNsttplNFIDVAGGSGDIAFGLLDHAESK 136
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4OBW_A        87 Fgdt--------esTMDIVDINPDMLKEGEKRAMEQGKYfkdpRVRFLVSNGEKLEEIDsDSKDIYTVSFGIRNFTDIQK 158
gi 123561227  89 G-------------KVVLADINESMLKMGREKLRNIGVIg---NVEYVQANAEALPFPD-NTFDCITISFGLRNVTDKDK 151
gi 399775     73 G-------------EIKGLDFSENMLSVGEQKVKDGGFS----QIELLHGNAMELPFDD-DTFDYVTIGFGLRNVPDYLT 134
gi 1346175    79 G-------------KVIGLDFSENMLEIAKAKLKEEAKK----NIEFLQGNAMALPFEK-GSFDVVTIGYGLRNTPDYLT 140
gi 146102488  83 GqsfgivpktldgtKVVVCDINAMMLKEGQKRAEREGYM----DIDWVCASGEELPFED-GAFDSYTVSFGIRNFSDRPK 157
gi 1353083   137 Fgdt--------esTMDIVDINPDMLKEGEKRAMEQGKYfkdpRVRFLVSNGEKLEEIDsDSKDIYTVSFGIRNFTDIQK 208
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4OBW_A       159 GLNTAYRVLKPGGIFYCLEFSKIENPLMDFAYQQWAK-VLPVMGSMIANDYDSYQYLVESIERFPDQETFKSMIEKAGFK 237
gi 123561227 152 ALRSMYRVLKPGGRLLVLEFSKPIIEPLSKAYDAYSFhVLPRIGSLVANDADSYRYLAESIRMHPDQDTLKAMMQDAGFE 231
gi 399775    135 VLKEMRRVVKPGGQVVCLETSQPEMFGFRQAYFMYFKyIMPFFGKLFAKSYKEYSWLQESARDFPGMKELAGLFEEAGLK 214
gi 1346175   141 VLKEIFRVLKPGGRVVCIETSHPTLPIYKQAFELYFKnVMPFLGKVFAKSLKEYQWLQKSAEDFPDAKTLEELFRKAGFV 220
gi 146102488 158 ALREAFRVLKVGGALHVLEFSRVTCPLLSVPYELWSYgFMPQAGRMLADE-ESYRYLVDSIRAFPDQETFAQMIRDAGFG 236
gi 1353083   209 GLNTAYRVLKPGGIFYCLEFSKIENPLMDFAYQQWAK-VLPVMGSMIANDYDSYQYLVESIERFPDQETFKSMIEKAGFK 287
                        250
                 ....*....|....*....
4OBW_A       238 SAGYESLTFGICAIHWGIK 256
gi 123561227 232 SVDYYNLTAGVVALHRGYK 250
gi 399775    215 NVKYHSFTGGVAATHIGWK 233
gi 1346175   221 AVEYQKHGGGAIASHFATK 239
gi 146102488 237 YVRYENLTGGIACIHTGVK 255
gi 1353083   288 SAGYESLTFGICAIHWGIK 306
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap