Conserved Protein Domain Family
RNA_pol_L

?
pfam01193: RNA_pol_L 
RNA polymerase Rpb3/Rpb11 dimerization domain
The two eukaryotic subunits Rpb3 and Rpb11 dimerize to from a platform onto which the other subunits of the RNA polymerase assemble (D/L in archaea). The prokaryotic equivalent of the Rpb3/Rpb11 platform is the alpha-alpha dimer. The dimerization domain of the alpha subunit/Rpb3 is interrupted by an insert domain (pfam01000). Some of the alpha subunits also contain iron-sulphur binding domains (pfam00037). Rpb11 is found as a continuous domain. Members of this family include: alpha subunit from eubacteria, alpha subunits from chloroplasts, Rpb3 subunits from eukaryotes, Rpb11 subunits from eukaryotes, RpoD subunits from archaeal spp, and RpoL subunits from archaeal spp.
Statistics
?
Aligned: 458 rows
Threshold Bit Score: 27.8827
Threshold Setting Gi: 55976424
Created: 19-Jun-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EDU50529        63 QFSLTGIDTSVANAFRRILLSEIPTLAIEDVYiyqntsiiqdevLAHRLGLIPLcgdratlrrmkwyakptdedegsggP 142 Pyrenophora t...
Q9HR53          14 TIEVAGENHTFMNVLKGTLL-ETDGVTAASYD------------MNPEQSGGQT-------------------------- 54  Halobacterium...
WP_008524741    14 SIEISGEDHTFMNVLKGALL-ETDGVAAATYD------------MNPEQSGGQT-------------------------- 54  Halorhabdus t...
jgi:Maeo_0190   15 EVELIHDDHSLSNLLKDMLLDKKDKVVMASYA------------LEHPVLDPETdl---------------------hiS 61  Methanococcus...
Q6M0K9          15 ELELVNDDHSLSNLVKEILL-AKDGVILASYG------------VEHPVLDPDTgr---------------------yiS 60  Methanococcus...
jgi:Mvol_1700   13 EFELTNEDHSLPNILKDILL-SKENVIMASYN------------VEHPVLDPESgk---------------------yiS 58  Methanococcus...
jgi:Pyrfu_0179  15 EVRLRGEDHTMANLIVKLAI-RKPHVTYAAYR------------IDHPLVD----------------------------- 52  Pyrolobus fum...
jgi:Arcpr_0725  14 KLEIRGEDHTYLNLLQHYLL-EDEDVEIARYY------------IPHPLQD----------------------------- 51  Archaeoglobus...
A0B533          14 RIEFEGERHTLLNLLRSELL-EDERVVIATYD------------AKFPIMD----------------------------- 51  Methanothrix ...
EHQ35019        14 RILFVGEGHTFMNALSDEIL-KDPQVDVANYS------------SRFKFTD----------------------------- 51  Methanoplanus...
EDU50529       143 tsentvaltlktkctwqpggvaravagetdpdrlyvghnvyakdmrfepngnqaenlseaegkhirstnpdilickmrpg 222 Pyrenophora t...
Q9HR53             -------------------------------------------------------------------------------- Halobacterium...
WP_008524741       -------------------------------------------------------------------------------- Halorhabdus t...
jgi:Maeo_0190      -------------------------------------------------------------------------------- Methanococcus...
Q6M0K9             -------------------------------------------------------------------------------- Methanococcus...
jgi:Mvol_1700      -------------------------------------------------------------------------------- Methanococcus...
jgi:Pyrfu_0179     -------------------------------------------------------------------------------- Pyrolobus fum...
jgi:Arcpr_0725     -------------------------------------------------------------------------------- Archaeoglobus...
A0B533             -------------------------------------------------------------------------------- Methanothrix ...
EHQ35019           -------------------------------------------------------------------------------- Methanoplanus...
EDU50529       223 qeleirmhaikgigqdhakfSPVatasyrlmptiditkpivgadakkfsrcfpsgvirldtvtsadiekhpelegkegep 302 Pyrenophora t...
Q9HR53          55 --------------------EPL--------------------------------------------------------- 57  Halobacterium...
WP_008524741    55 --------------------DPI--------------------------------------------------------- 57  Halorhabdus t...
jgi:Maeo_0190   62 --------------------NPI--------------------------------------------------------- 64  Methanococcus...
Q6M0K9          61 --------------------NPT--------------------------------------------------------- 63  Methanococcus...
jgi:Mvol_1700   59 --------------------NPL--------------------------------------------------------- 61  Methanococcus...
jgi:Pyrfu_0179  53 --------------------DPV--------------------------------------------------------- 55  Pyrolobus fum...
jgi:Arcpr_0725  52 --------------------RAE--------------------------------------------------------- 54  Archaeoglobus...
A0B533          52 --------------------NPV--------------------------------------------------------- 54  Methanothrix ...
EHQ35019        52 ---------------------PI--------------------------------------------------------- 53  Methanoplanus...
EDU50529       303 kavvanpmndtvsreclrhpefkdkvklgrirdhFIFRVEstGQWESDELFLESVKLLKIKC 364 Pyrenophora tritici-repentis Pt...
Q9HR53          58 ----------------------------------LTIKTD--GDVDPVDALQAAAGHTSQKL 83  Halobacterium salinarum NRC-1
WP_008524741    58 ----------------------------------LTIKTE--SGTDALDALEAGAQHVIEKA 83  Halorhabdus tiamatea
jgi:Maeo_0190   65 ----------------------------------LILKTT--EGVNAEEVLKEALKEIIDLC 90  Methanococcus aeolicus Nankai-3
Q6M0K9          64 ----------------------------------IMLKTD--EKTDAETVLKEALKDIVDLC 89  Methanococcus maripaludis S2
jgi:Mvol_1700   62 ----------------------------------LVLETV--EGTNAVEILKESLSDLIALC 87  Methanococcus voltae A3
jgi:Pyrfu_0179  56 ----------------------------------VVIATD--GTVSPIDVLENVLNEIVKLC 81  Pyrolobus fumarii 1A
jgi:Arcpr_0725  55 ----------------------------------LVVKTK--SK-NPLEAIKEANEKIVKAC 79  Archaeoglobus profundus DSM 5631
A0B533          55 ----------------------------------FRLKTR---GVDPLDVIRDASARIADLC 79  Methanothrix thermoacetophila PT
EHQ35019        54 ----------------------------------LTVTVK--EGGDPVGAVLKAAGKISENC 79  Methanoplanus limicola DSM 2279
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap