1DIP


Conserved Protein Domain Family
TSC22

?
pfam01166: TSC22 
Click on image for an interactive view with Cn3D
TSC-22/dip/bun family
Statistics
?
PSSM-Id: 366499
View PSSM: pfam01166
Aligned: 24 rows
Threshold Bit Score: 64.6074
Threshold Setting Gi: 555706826
Created: 24-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1DIP_A          2 MDLVKNHLMYAVREEVEILKEQIRELVEKNSQLERENTLLKTLASPEQLEKFQS 55   pig
OZF84150       57 MDLVKTHLMFAVREEVDGLRSKIFDLENHVRRLEAENSILKRTIPNDTLKQLHL 110  Caenorhabditis remanei
Q9U290        488 MELVKTHLTYAVREEVDTLRNTIAELEYQMRESQYECTYYRQNCAPDLIEQASS 541  Caenorhabditis elegans
Q22544         72 MDLVKTHLTFAVREEVETLRTTITDLEARLNALREENRLLRENVSPEVLAFITA 125  Caenorhabditis elegans
EJW82495      183 MDLVKTHLTFAVREEVEILRSTIVELEAKVAQLESQNQVLKQFAPVEVVNSLTV 236  Wuchereria bancrofti
EEB20409        1 MDLVKTHLMLTVREEVEVLKDKITELMDRISQLEVENTILKAHASQETLSQLSS 54   human body louse
PDM64843      422 MDLVKTHLTFAVREEVEILRTTIAELESRVTTLETQNTYLKRHVTPEVMSNLPG 475  Pristionchus pacificus
EGT48249      436 MELVKTHLTYAVREEVDTLRNTIADLEYQMREFQYECNFYRQNCAPEVVEQASN 489  Caenorhabditis brenneri
XP_014292870  993 MDLVKSHLMYAVREEVEVLKEKIAELMERIGQLEAENATLRAGATPETLALLPP 1046 brown marmorated stink bug
XP_018667888  456 MDLVKKHLMLAVRDEVDELKDKIVELQDDNFKMKLENETLKGILTPEQFNIAQQ 509  vase tunicate
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap