3J61,3J21,1S72


Conserved Protein Domain Family
Ribosomal_L21e

?
pfam01157: Ribosomal_L21e 
Click on image for an interactive view with Cn3D
Ribosomal protein L21e
Statistics
?
Aligned: 173 rows
Threshold Bit Score: 96.3867
Threshold Setting Gi: 157921343
Created: 24-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3J61_T             1 MPAGHGLRSRTRDLFARPFRKKGYIPLTTYLRTYKVGEHVDVKVNGAVHKGMPHKFYHGRTGRVWNVTKRAIGVEINKQV 80  bread wheat
ELQ74124           1 MTSSKGYRRQTRKRFSQPFRKHGMPSISTYLTTYKRGDYVDIKVNPAVHKGMPHKYYHGLTGKVAVVHKNSLTVRCTRRF 80  Trachipleis...
EPR79136           1 MVSSHGYRRQTRNLFSQAFRKHGMPNTSTYLTQYAVGEYVDIKVNPAIHKGMPHKYYHGRTGIIKEVNRGSVIVLFNRIL 80  Spraguea lo...
EED44150           1 -MRSKGYRRGTRSLFSKGQKEHGNPTLTKTIQQFRIGDLVDIKIDPSVVKGMPHKYYHGKTGRIFNINNRSVGIILYRCV 79  Enterocytoz...
jgi:MSWAN_2288     2 VKRSKGFRSKTRFKLKKSIRPVRANNITKRIQIFNEDDLVHIIIDPSIQKGQPHPRFHGQTGRV--ANRRGRAYIVQIND 79  Methanobact...
CDG66009           2 TQRSRGFRSKTRYKLKKTLRAGRSNPITKKIQTFQEDDMVHIIIDPSVHKGQPHPRFHGKTGKI--TDKRGQAYLVSIKD 79  Methanobact...
NZAGRC:Abm4_1658   1 MQRSRGFKSRSRNKLTKKPRVGRSNPITKKLQTFNEGDLVHIIIDPSIHRGQPHSRFHGKTAKV--IGKRGSAYLLGLKD 78  Methanobrev...
A6UT27             1 MQKSEGFRSGTRYKLKKHPRAKGLYPITRALKQFENGQTVHVILDPSVQKGMPHPKFHGKTGKI--IGQRGSSFIVEVKD 78  Methanococc...
jgi:Mvol_1446      1 MQKSEGFRSKTRYKLKKHPRQRGLFPLTRALRVYKIGETVHVVLDPSVQKGMPHPKFHGKTGKV--VAQRGSSYLVKVKD 78  Methanococc...
EHY65329           1 -MRSKGYRSKTRSVFKKDYDQSKRPQTTTLLNQYKRGDYVDISVDSGVHKGMPHRTFVGKTGRVYAVFKTSVGIALTKQC 79  Nematocida ...
3J61_T            81 GNRIIKKRIHVRVEHVQPSRC 101 bread wheat
ELQ74124          81 GNKRIHRMIVCRVEHLRKSKC 101 Trachipleistophora hominis
EPR79136          81 ANKTVERKVIVGIEHIRKSKC 101 Spraguea lophii 42_110
EED44150          80 GHKFIERHVNARVEHLTLSRS 100 Enterocytozoon bieneusi H348
jgi:MSWAN_2288    80 GNK--AKKLIIRPEHLKMQE- 97  Methanobacterium paludis
CDG66009          80 GNK--AKKLIIRPEHLKIQE- 97  Methanobacterium sp. MB1
NZAGRC:Abm4_1658  79 GNK--YKELIVRPDHLKLQE- 96  Methanobrevibacter sp. AbM4
A6UT27            79 GHA--TKEIIARPQHLRECKN 97  Methanococcus aeolicus Nankai-3
jgi:Mvol_1446     79 GGK--YKDIIARPQHLRESKA 97  Methanococcus voltae A3
EHY65329          80 GNSLVVKKVIARIEHVRPSQC 100 Nematocida sp. 1 ERTm2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap