2WYA


Conserved Protein Domain Family
HMG_CoA_synt_N

?
pfam01154: HMG_CoA_synt_N 
Click on image for an interactive view with Cn3D
Hydroxymethylglutaryl-coenzyme A synthase N terminal
Statistics
?
PSSM-Id: 307348
View PSSM: pfam01154
Aligned: 4 rows
Threshold Bit Score: 350.767
Threshold Setting Gi: 1708241
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2WYA_A   3 PKDVGILALEVYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQEDINSLCLTVVQRLMERIQLPWDSVGRLEVG 82  human
P22791  51 PKDVGILALEVYFPAQYVDQTDLEKFNNVEAGKYTVGLGQTRMGFCSVQEDINSLCLTVVQRLMERTKLPWDAVGRLEVG 130 Norway rat
P54839  46 PQNVGIKGIQIYIPTQCVNQSELEKFDGVSQGKYTIGLGQTNMSFVNDREDIYSMSLTVLSKLIKSYNIDTNKIGRLEVG 125 Saccharomyces cerevis...
P17425  14 PKDVGIVALEIYFPSQYVDQAELEKYDGVDAGKYTIGLGQARMGFCTDREDINSLCLTVVQKLMERNSLSYDCIGRLEVG 93  Norway rat
2WYA_A  83 TETIIDKSKAVKTVLMELFQDSGNTDIEGIDTTNACYGGTASLFNAANWMESSSWDGRYAMVVCGDIAVYPSGNARPTGG 162 human
P22791 131 TETIIDKSKAVKTVLMELFQDSGNTDIEGIDTTNACYGGTASLFNAANWMESSYWDGRYALVVCGDIAVYPSGNPRPTGG 210 Norway rat
P54839 126 TETLIDKSKSVKSVLMQLFGE--NTDVEGIDTLNACYGGTNALFNSLNWIESNAWDGRDAIVVCGDIAIYDKGAARPTGG 203 Saccharomyces cerevis...
P17425  94 TETIIDKSKSVKSNLMQLFEESGNTDIEGIDTTNACYGGTAAVFNAVNWIESSSWDGRYALVVAGDIAIYASGNARPTGG 173 Norway rat
2WYA_A 163 AGAVAMLIGPKAP 175 human
P22791 211 AGAVAMLIGPKAP 223 Norway rat
P54839 204 AGTVAMWIGPDAP 216 Saccharomyces cerevisiae S288c
P17425 174 VGAVALLIGPNAP 186 Norway rat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap