1QMH


Conserved Protein Domain Family
RTC

?
pfam01137: RTC 
Click on image for an interactive view with Cn3D
RNA 3'-terminal phosphate cyclase
RNA cyclases are a family of RNA-modifying enzymes that are conserved in all cellular organisms. They catalyze the ATP-dependent conversion of the 3'-phosphate to the 2',3'-cyclic phosphodiester at the end of RNA, in a reaction involving formation of the covalent AMP-cyclase intermediate. The structure of RTC demonstrates that RTCs are comprised two domain. The larger domain contains an insert domain of approximately 100 amino acids.
Statistics
?
PSSM-Id: 334399
View PSSM: pfam01137
Aligned: 174 rows
Threshold Bit Score: 223.552
Threshold Setting Gi: 167999777
Created: 16-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QMH_A        12 QGEGGGQILRSALSLSMITGQPFTITSIRA-GRAKPGLLRQHLTAVKAATEICGATVEGAELGSQRLLFRPGTV-R-GGD 88
gi 172044462   8 FGEGGGQILRTSVALSAVTLKPVRIFNIRA-KRKNPGLRRQHMVAVKALAEMTDAEVRGLELGSTEIVFIPKTL-K-AGT 84
gi 123725297   8 QKSGSGTIVRDAVSLSALAGRDLHLTNIRAkRRPKPGLRAQHLRGIEAIAELCRGRLEGAAISSGEIRFFPGQT-IrGGR 86
gi 119367361   8 YGEGGGQLLRTSVALAAITGQSVRVYNIRA-KRSNPGLAPQHLTAVKAVAALCRARTEGMEVKSQEIIFRPGPL-R-GGE 84
gi 501259222  17 ersGSGTIVRYAVALSALAGRELHLTNIRA-RRQKPGLRPQHLKAVEAVRDLCGGQLEGAVVGASEILFRPGTVlR-GGD 94
gi 503732619   8 YGEGGGQLLRLAVALAAITGTRVCITNIRA-RRDKPGLAPQHLTGVQAVGQLCGAKIEGLTPRSQQITFEPARL-R-GGD 84
gi 502605649  13 RHSGSGTLVRQAVALAALVGRPLRLYNVRA-RRQPPGLRPQHLKAVEAVAELVDARLEGAEVGSQRLTFVPRRR-PrGGT 90
gi 383795867  11 LGEGGGQILRTSLALSAILGMPLKVINIRA-KRENPGLQHQHITAVKVVSALSNAKTEGLYLGSKELLFYPNKL-S-GGN 87
gi 343459643  10 MGEGGGQILRTSVALAAVLGIKLRVYNIRA-KRKNPGLQRQHMTAIRAVAALTNARVEGLKLGSTSIVFEPREL-R-GGK 86
gi 304377051   8 IGEGGGQILRSAIGLATALGKDIKIVNIRA-KRRNPGLQHQHLTAVRAVAEISNASIDGGYIGSKELMFRPGRI-R-GGV 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QMH_A        89 YRFAIGSAGSCTLVLQTVLPALWFADgpsRVEVSGGTDNPSAPPADFIRRVLEPLLAKIGIHQQTTLLRHGFYPAGGGVV 168
gi 172044462  85 FRFDIGTAGSVSLVLQAVTPAALFAPgevRVQLRGGTDVPMSPPVDYLRFVFYPLLERFGAKTELVLKRRGHYPKGGGEV 164
gi 123725297  87 YDWDIGTAGSTTMLVLCVLPLALFADgpsLFRITGGLFQDFAPSVYSLQTVLLPLLRRMGAQIDLRIMRPGYVPQGQGQI 166
gi 119367361  85 YDFPIGTAGSVTLVLQAALPVALACGekvRMNISGGTDVRAAPPLDYFRYVLLPLVYSMGARAKIEVLLRGYYPRGGGKV 164
gi 501259222  95 YRWDIETGGSAVMLALTILPPAILAGapgTFHITGGLFQDFAPSAYHLQRVLLPLLSRMGADTRLEIVRPGYVPQGGGEL 174
gi 503732619  85 YRFDVGTAGSITLVLQALLPVMLAAQmpcKVHITGGTDIRQAPAADYLREVLIRLIERLGARVTIRVLRRGYYPRGGGEI 164
gi 502605649  91 YRWDIGTAGSATLLVQTVLPVLAFADgpsRALIRGGLFQDFAPTYFHLRHALLPLLHRMGLVARLEMLRPGYVPRGGGEL 170
gi 383795867  88 FEFDVGTAGSVMLVLQAILPILPFLEtstKIVLKGGTDVPGAPTFDYFKNVTLELLKRIGIDMKANIKRRGYYPKGGGIV 167
gi 343459643  87 YRFDIGTAGSVTLVLQALLPVAAFVPeplEVEIRGGTDVPWSPPVDYVRFVLRPLLEKFGYHFDIIVKRRGHYPKGGGIV 166
gi 304377051  85 YRFDIGTAGSTTLVLQALLPILPFLDresVIEIIGGTDVPWSPPIDYIRYVLMPILKMFRYRIDVELIRRGHYPRGGGMI 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QMH_A       169 ATEVSpVAS-FNTLQLGERGNIVQMRGEVLLAGVP-RHVAEREIATLAGSF-----SLHEQNIhnl------prDQG--- 232
gi 172044462 165 EF-ASrPVDsLTQWGEVERGEVLKVRGLSHCVKLP-KHVAERQAKAAEEVLkksglKNVDIDLewy-----ppeRDPhlg 237
gi 123725297 167 TVDVTpLKRpLKPLILTAQGNLLEIRGIALSSLLK-ERQVSERMAEECRKTlqaegHDARIDLlydtagnpvyeKSAvqa 245
gi 119367361 165 VVDVE-PCLpLRPVLLNASEGLEGITGFVHISNLP-KHIIHRMANGALAELstfptPAVGLEVf---------gKDDaig 233
gi 501259222 175 LLEVRpAAGgLKPLVLSEQGRIESVSGIALSSHLSdRHVGERMAAAAAGVFraaghEALIdvv---------ddALSvqp 245
gi 503732619 165 ELAVEpAT--LVPAVFDATGHIKAIYGITHVANLP-EHIALRMKQAVLDQLgayatQAS-FETqil------ghEAAfgp 234
gi 502605649 171 LLDVTpLQApLRPLRLEQQGRPVRVFGVALASHLK-QRRVARRMADRCRQRlleagLPEPHIEti-------ddTSAyqp 242
gi 383795867 168 DIFIEsPKGrLKNIELVKRGELKKIKIFSVAHKLP-SHIAKRQALSAQSFLeerlqGILYETEiedd---eknhELAsfs 243
gi 343459643 167 IFRVDnPPRrLHSIELEERGEVLAFKGLSHCVRLP-KHVAERQARSAASVIrarypDVPLKIDleyy----tpgKDPhlg 241
gi 304377051 165 RVRAI-PTGfIEPIDLVDRGDLELIGGRSHCVKLP-SHVAERQARAAKEYLaskglNIPIDIElefy----dpqKDPhlg 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1QMH_A       233 PGNTVSLEVESENITERFFVVGEKRVSAEVVAAQLVKEVKRYLASTAAVGEYLADQLVLPMALA-GAgeFTVAHPSCHLL 311
gi 172044462 238 PGSGIVLWAITERSLLGADSLGARGKRAERVGEEAARKLLEDLSTGKALDRHMSDMIVPYVSLAcGRteVGGAALTMHAW 317
gi 123725297 246 GAALALWAKTDTECLLGADRAGAPRRSSETIGRQVARMMTETLQTGATLDVHAADQIIPFAALAeGEssFVIPRMTDHID 325
gi 119367361 234 EGGAVLLTAHKEHSRLGASAVAERGVPAERLGAEAGRCLREEILSGATLDIHAADQVLIYLALAsGVscFLTRELSSHAA 313
gi 501259222 246 GAALAAWAVTATGCILGADQAGQPRRPAEHIGRHVARTLLADLAAGATVDRFAADQLVIFAALArGEtvYRVPLFTEHLE 325
gi 503732619 235 GGAIVCW-IKREHTVLGAARVAKRDVRAEALGEAVGKELAADLAAGAALDVHAADQILVYLALAgGGs-FSTRSASLHAR 312
gi 502605649 243 GAALAVFVETDTGALLGADQAGAPGRPSEAIADNVARMLLEDLRSGATVDRHLADQLIPYVALAdGTsaYHVPEVTDHVA 322
gi 383795867 244 PGTSISIIAEAKESILGGDSLGKKGKPAEKVGEDAAKVLIEDISTQMALDRFMSDMIIPFLALAkGKskVGGSRLTLHAI 323
gi 343459643 242 PGSGIVVYAETENSVLGGDSLGAKGKPAERVGEEAARKLIEDLETGKALDRHASDMLIPFAALAeGEsvLGGAKLTLHAY 321
gi 304377051 239 PGSGIVLYAKASRAILGGDSLGEKGKPAEVVGREAAEKLYEEIVSGAALDRHAGDMVIPIAAIAkGEsrFTVSTITLHME 318
                        330
                 ....*....|....*.
1QMH_A       312 TNIAVVERFLPVRFSL 327
gi 172044462 318 THVHVVKKFL---PEL 330
gi 123725297 326 SRLWLVETFLGAETEL 341
gi 119367361 314 TTIWLLEQFLPVRFQV 329
gi 501259222 326 TNLWLVEKILGAGVRV 341
gi 503732619 313 TAMWLIEQFLPVTFGV 328
gi 502605649 323 SSCWLVEAFFNVTVEL 338
gi 383795867 324 TNILVIEKILNIKAKV 339
gi 343459643 322 TNLLVVEKLTGIKYEL 337
gi 304377051 319 TVIEIAKILTGCEINI 334
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap