1R18,2YXE,1DL5,3LBF


Conserved Protein Domain Family
PCMT

?
pfam01135: PCMT 
Click on image for an interactive view with Cn3D
Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)
Statistics
?
PSSM-Id: 250389
View PSSM: pfam01135
Aligned: 9 rows
Threshold Bit Score: 291.579
Threshold Setting Gi: 12084576
Created: 13-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1R18_A  14 AN-NEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPR-----NPYMDAPQPIGGG-----VTISAPHMHAFALEYLRdhL 82  fruit fly
P15246   8 AS-HSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKC-----NPYMDSPQSIGFQ-----ATISAPHMHAYALELLFdqL 76  cattle
Q43209  10 LEkNNALVEYLKQYGVVRTDKVAEVMETIDRALFVPEg---fTPYTDSPMPIGYN-----ATISAPHMHATCLELLKdyL 81  bread wheat
Q27873   8 ST-NSELIDNLRNNRVFASQRAYDAMKSVDRGDFAPR-----APYEDAPQRIGYN-----ATVSAPHMHAAALDYLQnhL 76  Caenorhabditis elegans
Q42539  11 NK-NKAMVENLQNHGIVTSDEVAKAMEAVDRGVFVTDr---sSAYVDSPMSIGYN-----VTISAPHMHAMCLQLLEkhL 81  thale cress
2YXE_A   5 EQ-KKAVIEKLIREGYIKSKRVIDALLKVPREEFLPEhl-keYAYVDTPLEIGYG-----QTISAIHMVGMMCELLD--L 75  Methanocaldococcus ja...
1DL5_B   1 MR--EKLFWILKKYG--VSDHIAKAFLEIPREEFLTKsyplsYVYEDIVL-VSYDdgeeySTSSQPSLMALFMEWVG--L 73  Thermotoga maritima
3LBF_A   6 RR-VQALLDQLRAQG-IQDEQVLNALAAVPREKFVDEaf-eqKAWDNIALPIGQG-----QTISQPYMVARMTELLE--L 75  Escherichia coli K-12
P56133   2 NSiKNHLMCEEINKRFNLHPKVREAMESIEREVFVPApf-khFAYTLNALSMQAQ-----QYISSPLTVAKMTQYLE--I 73  Helicobacter pylori 2...
1R18_A  83 KPGARILDVGSGSGYLTACFYRYIKAKGvdadtRIVGIEHQAELVRRSKANLNTDDRSmld-sgQLLIVEGDGRKGYPPN 161 fruit fly
P15246  77 NEGAKALDVGSGSGILTACFARMVGPSG-----KVIGIDHIKELVDDSINNVRKDDPMlls-sgRVQLVVGDGRMGYAAE 150 cattle
Q43209  82 QPGMHALDVGSGSGYLTACFAMMVGPEG-----RAVGIEHIPELVVASTENVERSAAAalmkdgSLSFHVSDGRLGWPDA 156 bread wheat
Q27873  77 VAGAKALDVGSGSGYLTVCMAMMVGRNG-----TVVGIEHMPQLVELSEKNIRKHHSEqle-rgNVIIIEGDGRQGFAEK 150 Caenorhabditis elegans
Q42539  82 KPGMRVLDVGSGTGYLTACFAVMVGTEG-----RAIGVEHIPELVASSVKNIEASAASpflkegSLAVHVGDGRQGWAEF 156 thale cress
2YXE_A  76 KPGMKVLEIGTGCGYHAAVTAEIVGEDG-----LVVSIERIPELAEKAERTLRKLGYD------NVIVIVGDGTLGYEPL 144 Methanocaldococcus ja...
1DL5_B  74 DKGMRVLEIGGGTGYNAAVMSRVVGEKG-----LVVSVEYSRKICEIAKRNVERLGIE------NVIFVCGDGYYGVPEF 142 Thermotoga maritima
3LBF_A  76 TPQSRVLEIGTGSGYQTAILAHLVQHVC--------SVERIKGLQWQARRRLKNLDLH------NVSTRHGDGWQGWQAR 141 Escherichia coli K-12
P56133  74 DHVDSVLEIGCGSGYQAAVLSQIFRRVF--------SIERIESLYIEARLRLKTLGLD------NVHVKFADGNKGWEQY 139 Helicobacter pylori 2...
1R18_A 162 APYNAIHVGAAAPDTPTELINQLASGGRLIVPVGp-dGGSQYMQQYDKDANGKVEMTRLMGVMYVPL 227 fruit fly
P15246 151 APYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGp-aGGNQMLEQYDKLQDGSVKMKPLMGVIYVPL 216 cattle
Q43209 157 APYDAIHVGAAAPEIPRPLLEQLKPGGRMVIPVG---TYSQDLQVIDKSADGSTSVRNDASVRYVPL 220 bread wheat
Q27873 151 APYNAIHVGAASKGVPKALTDQLAEGGRMMIPVEq-vDGNQVFMQIDKIN-GKIEQKIVEHVIYVPL 215 Caenorhabditis elegans
Q42539 157 APYDAIHVGAAAPEIPEALIDQLKPGGRLVIPVG---NIFQDLQVVDKNSDGSVSIKDETSVRYVPL 220 thale cress
2YXE_A 145 APYDRIYTTAAGPKIPEPLIRQLKDGGKLLMPVG---RYLQRLVLAEKRG-DEIIIKDCGPVAFVPL 207 Methanocaldococcus jannaschii DSM ...
1DL5_B 143 SPYDVIFVTVGVDEVPETWFTQLKEGGRVIVPINlklSRRQPAFLFKKKD-PYLVGNYKLETRFITA 208 Thermotoga maritima
3LBF_A 142 APFDAIIVTAAPPEIPTALMTQLDEGGILVLPVG---EEHQYLKRVRRRG-GEFIIDTVEAVRFVPL 204 Escherichia coli K-12
P56133 140 APYDRILFSACAKNIPQALIDQLEEGGILVAPIQe--NNEQVIKRFVKQNNALRVQKVLEKCLFVPV 204 Helicobacter pylori 26695
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap