1I1N,2YXE,3LBF,1DL5


Conserved Protein Domain Family
PCMT

?
pfam01135: PCMT 
Click on image for an interactive view with Cn3D
Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)
Statistics
?
Aligned: 13 rows
Threshold Bit Score: 297.36
Threshold Setting Gi: 2499573
Created: 14-Mar-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1I1N_A   7 AS-HSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKC-----NPYMDSPQSIGFQ-----ATISAPHMHAYALELLfdQ- 74  human
P15246   8 AS-HSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKC-----NPYMDSPQSIGFQ-----ATISAPHMHAYALELL--Fd 74  cattle
Q27869   8 AN-NEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPR-----NPYMDAPQPIGGG-----VTISAPHMHAFALEYL--Rd 74  fruit fly
Q27873   8 ST-NSELIDNLRNNRVFASQRAYDAMKSVDRGDFAPR-----APYEDAPQRIGYN-----ATVSAPHMHAAALDYL--Qn 74  Caenorhabditis elegans
Q42539  11 NK-NKAMVENLQNHGIVTSDEVAKAMEAVDRGVFVTDr---sSAYVDSPMSIGYN-----VTISAPHMHAMCLQLL--Ek 79  thale cress
Q57636   5 EQ-KKAVIEKLIREGYIKSKRVIDALLKVPREEFLPEhl-keYAYVDTPLEIGYG-----QTISAIHMVGMMCELL--D- 74  Methanocaldococcus ja...
Q56308   1 MR--EKLFWILKKYG--VSDHIAKAFLEIPREEFLTKsyplsYVYEDIVL-VSYDdgeeySTSSQPSLMALFMEWV--G- 72  Thermotoga maritima MSB8
P0A7A5   4 RR-VQALLDQLRAQG-IQDEQVLNALAAVPREKFVDEaf-eqKAWDNIALPIGQG-----QTISQPYMVARMTELL--E- 72  Escherichia coli K-12
P56133   2 NSiKNHLMCEEINKRFNLHPKVREAMESIEREVFVPApf-khFAYTLNALSMQAQ-----QYISSPLTVAKMTQYL--E- 72  Helicobacter pylori 2...
Q43209  10 LEkNNALVEYLKQYGVVRTDKVAEVMETIDRALFVPEg---fTPYTDSPMPIGYN-----ATISAPHMHATCLELL--Kd 79  bread wheat
2YXE_A   5 EQ-KKAVIEKLIREGYIKSKRVIDALLKVPREEFLPEhl-keYAYVDTPLEIGYG-----QTISAIHMVGMMCELL--D- 74  Methanocaldococcus ja...
3LBF_A   6 RR-VQALLDQLRAQG-IQDEQVLNALAAVPREKFVDEaf-eqKAWDNIALPIGQG-----QTISQPYMVARMTELL--E- 74  Escherichia coli K-12
1DL5_A   1 --mrEKLFWILKKYGV--SDHIAKAFLEIPREEFLTKsyplsYVYEDIVL-VSYDdgeeySTSSQPSLMALFMEWV--G- 72  Thermotoga maritima MSB8
1I1N_A  75 -LHEGAKALDVGSGSGILTACFARMVGCTG-----KVIGIDHIKELVDDSVNNVRKDDPTlls-sgRVQLVVGDGRMGYA 147 human
P15246  75 qLNEGAKALDVGSGSGILTACFARMVGPSG-----KVIGIDHIKELVDDSINNVRKDDPMlls-sgRVQLVVGDGRMGYA 148 cattle
Q27869  75 hLKPGARILDVGSGSGYLTACFYRYIKAKGvdadtRIVGIEHQAELVRRSKANLNTDDRSmld-sgQLLIVEGDGRKGYP 153 fruit fly
Q27873  75 hLVAGAKALDVGSGSGYLTVCMAMMVGRNG-----TVVGIEHMPQLVELSEKNIRKHHSEqle-rgNVIIIEGDGRQGFA 148 Caenorhabditis elegans
Q42539  80 hLKPGMRVLDVGSGTGYLTACFAVMVGTEG-----RAIGVEHIPELVASSVKNIEASAASpflkegSLAVHVGDGRQGWA 154 thale cress
Q57636  75 -LKPGMKVLEIGTGCGYHAAVTAEIVGEDG-----LVVSIERIPELAEKAERTLRKLGYD------NVIVIVGDGTLGYE 142 Methanocaldococcus ja...
Q56308  73 -LDKGMRVLEIGGGTGYNAAVMSRVVGEKG-----LVVSVEYSRKICEIAKRNVERLGIE------NVIFVCGDGYYGVP 140 Thermotoga maritima MSB8
P0A7A5  73 -LTPQSRVLEIGTGSGYQTAILAHLVQHVC--------SVERIKGLQWQARRRLKNLDLH------NVSTRHGDGWQGWQ 137 Escherichia coli K-12
P56133  73 -IDHVDSVLEIGCGSGYQAAVLSQIFRRVF--------SIERIESLYIEARLRLKTLGLD------NVHVKFADGNKGWE 137 Helicobacter pylori 2...
Q43209  80 yLQPGMHALDVGSGSGYLTACFAMMVGPEG-----RAVGIEHIPELVVASTENVERSAAAalmkdgSLSFHVSDGRLGWP 154 bread wheat
2YXE_A  75 -LKPGMKVLEIGTGCGYHAAVTAEIVGEDG-----LVVSIERIPELAEKAERTLRKLGYD------NVIVIVGDGTLGYE 142 Methanocaldococcus ja...
3LBF_A  75 -LTPQSRVLEIGTGSGYQTAILAHLVQHVC--------SVERIKGLQWQARRRLKNLDLH------NVSTRHGDGWQGWQ 139 Escherichia coli K-12
1DL5_A  73 -LDKGMRVLEIGGGTGYNAAVMSRVVGEKG-----LVVSVEYSRKICEIAKRNVERLGIE------NVIFVCGDGYYGVP 140 Thermotoga maritima MSB8
1I1N_A 148 EEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGp-aGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEK 220 human
P15246 149 AEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGp-aGGNQMLEQYDKLQDGSVKMKPLMGVIYVPLTDKEK 221 cattle
Q27869 154 PNAPYNAIHVGAAAPDTPTELINQLASGGRLIVPVGp-dGGSQYMQQYDKDANGKVEMTRLMGVMYVPLTDLRS 226 fruit fly
Q27873 149 EKAPYNAIHVGAASKGVPKALTDQLAEGGRMMIPVEq-vDGNQVFMQIDKIN-GKIEQKIVEHVIYVPLTSREE 220 Caenorhabditis elegans
Q42539 155 EFAPYDAIHVGAAAPEIPEALIDQLKPGGRLVIPVG---NIFQDLQVVDKNSDGSVSIKDETSVRYVPLTSREA 225 thale cress
Q57636 143 PLAPYDRIYTTAAGPKIPEPLIRQLKDGGKLLMPVG---RYLQRLVLAEKRG-DEIIIKDCGPVAFVPLVGKEG 212 Methanocaldococcus jannasch...
Q56308 141 EFSPYDVIFVTVGVDEVPETWFTQLKEGGRVIVPINlklSRRQPAFLFKKKD-PYLVGNYKLETRFITAGGNLG 213 Thermotoga maritima MSB8
P0A7A5 138 ARAPFDAIIVTAAPPEIPTALMTQLDEGGILVLPVG---EEHQYLKRVRRRG-GEFIIDTVEAVRFVPLVKGEL 207 Escherichia coli K-12
P56133 138 QYAPYDRILFSACAKNIPQALIDQLEEGGILVAPIQe--NNEQVIKRFVKQNNALRVQKVLEKCLFVPVVDGVQ 209 Helicobacter pylori 26695
Q43209 155 DAAPYDAIHVGAAAPEIPRPLLEQLKPGGRMVIPVG---TYSQDLQVIDKSADGSTSVRNDASVRYVPLTSRSA 225 bread wheat
2YXE_A 143 PLAPYDRIYTTAAGPKIPEPLIRQLKDGGKLLMPVG---RYLQRLVLAEKRGD-EIIIKDCGPVAFVPLVGKEG 212 Methanocaldococcus jannasch...
3LBF_A 140 ARAPFDAIIVTAAPPEIPTALMTQLDEGGILVLPVGe--E-HQYLKRVRRRG-GEFIIDTVEAVRFVPLVKGEL 209 Escherichia coli K-12
1DL5_A 141 EFSPYDVIFVTVGVDEVPETWFTQLKEGGRVIVPINlklSRRQPAFLFKKK-DPYLVGNYKLETRFITAGGNLG 213 Thermotoga maritima MSB8
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap