1JJV,1VHL,1UF9


Conserved Protein Domain Family
CoaE

?
pfam01121: CoaE 
Click on image for an interactive view with Cn3D
Dephospho-CoA kinase
This family catalyzes the phosphorylation of the 3'-hydroxyl group of dephosphocoenzyme A to form Coenzyme A EC:2.7.1.24. This enzyme uses ATP in its reaction.
Statistics
?
Aligned: 14 rows
Threshold Bit Score: 200.22
Threshold Setting Gi: 39654906
Created: 24-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1JJV_A          3 YIVGLTGGIGSGKTTIANLFTD-LGVPLVDADVVAREVVAKDSPLLSKIVEHFG---AQILTEQ--GELNRAALRERVFN 76  Haemophilus in...
Q50178          2 LCIGITGGIGAGKSLLSSTFSQ-CGGIVVDGDVLAREVVQPGTKGLSSLVDAFG---QDILLPG--GALDRRALAVKAFR 75  Mycobacterium ...
P44920          3 YIVGLTGGIGSGKTTIANLFTD-LGVPLVDADVVAREVVAKDSPLLSKIVEHFG---AQILTEQ--GELNRAALRERVFN 76  Haemophilus in...
Q7MHT5          3 LVIGLTGGIASGKTTVANLFQQhFAIDIVDADIVARQVVAPGSAGLAAIVDHFG---ADILTRE--GELDRGQLRQRIFA 77  Vibrio vulnifi...
Q88Q65          9 WILGLTGGIGSGKSAAAERFVE-LGVHLVDADQAARWVVEPGRPALASIVERFG---PGVLQGD--GQLDRAALRQLIFA 82  Pseudomonas pu...
tigr:DNO_1122   1 MIVGLTGGIASGKTLCCNWFAA-QGCYIIDADLIAKELVTVGGVVWLQLRAHFG---ETIFYAD--GNLNRALLREKMFH 74  Dichelobacter ...
Q5F691          3 aWVGLTGGIGSGKSAAAQYFAD-LGVPRIDADAAAHSLTASDGIALPEIRRLFG---DTVFDTQ--GLLRRDILRKEIFA 76  Neisseria gono...
Q56416          9 IIIGITGNIGSGKSTVAALLRS-WGYPVLDLDALAARARENKEEELKRL---FP---EAVv----gGRLDRRALARLVFS 77  Thermus thermo...
Q03941          2 LVVGLTGGIACGKSTVSRRLRDkYKLPIVDADKIARQVVEPGQNAYDQIVLYFKdkiPNLLLED--GHLNREALGKWVFS 79  Saccharomyces ...
P34558         12 LVVGLSGGVATGKSTVSSVFRA-HGVPIIDADQVARQVVVPGTSTYNRLRKEFG---DEYFDDEhgGVLRRDKLGKLIFS 87  Caenorhabditis...
1JJV_A         77 HDEDKLWLNNLLHPAIRERMKQKLAEQTA---PYTLFVVPLLIEN-KLTALCDRILVVDVSPQTQLARSAQRD-NNNFEQ 151 Haemophilus in...
Q50178         76 DDAARNVLNGIVHPLVANRRAEIIAAISEd--AVVVEDIPLLVES-GMAHLFPLVVVVHADVELRVRRLVEQR-GVAETD 151 Mycobacterium ...
P44920         77 HDEDKLWLNNLLHPAIRERMKQKLAEQTA---PYTLFVVPLLIEN-KLTALCDRILVVDVSPQTQLARSAQRD-NNNFEQ 151 Haemophilus in...
Q7MHT5         78 HAEEKQWLNALLHPMIRRKMIEDLAQVSS---PYALLVVPLLVEN-QLQTLCDRVLVVDVEEKTQLQRTMDRD-GVDEQQ 152 Vibrio vulnifi...
Q88Q65         83 DPAQRKWLEQLLHPLIGQEIFSYLAKAQS---PYAVYVSPLLIES-GQHHKTQRVLVIDAPQDLQIARTLARD-NTSAEH 157 Pseudomonas pu...
tigr:DNO_1122  75 NQEIKEKVNQIFHPAVRAEIEKRIHLYPH---AFTLLDVPLLFET-QLHKICHMVIVVDIPVSLQIARGVCRD-GVNSAQ 149 Dichelobacter ...
Q5F691         77 SPSRKALLESVMLPLIFSEIKKQQETFTDa--VYGIVEIPLLTEKrQFISLIRRVLTISAPLEKRIGRVMARS-GLTRGE 153 Neisseria gono...
Q56416         78 DPERLKALEAVVHPEVRRLLMEELSRLEA---PLVFLEIPLLFEK-GWEGRLHGTLLVAAPLEERVRRVMARS-GLSREE 152 Thermus thermo...
Q03941         80 HKEDLQALNGITHPAIRYAMFKEIGYYYLkgyRMCVLDVPLLFEG-NLDSICGVTVSVICTQELQLERLMTRNpELSEED 158 Saccharomyces ...
P34558         88 NPEKRKALNGITHPAIRWEMFKQFLTLLItgtKYIVFDTPLLFES-GYDKWIGTTIVVWCDFEQEVERMVTRD-NISRAD 165 Caenorhabditis...
1JJV_A        152 IQRIMNSQVSQQERLKWADDVINNDAELAQ 181 Haemophilus influenzae Rd KW20
Q50178        152 ARARIAAQASDEERRAVADVWLDN-SSTPE 180 Mycobacterium leprae TN
P44920        152 IQRIMNSQVSQQERLKWADDVINNDAELAQ 181 Haemophilus influenzae Rd KW20
Q7MHT5        153 VRAILKAQASRHERLALADDVIKNESKDQd 182 Vibrio vulnificus YJ016
Q88Q65        158 VQAILQAQLAREDRLRHADDVVVNDGGLaa 187 Pseudomonas putida KT2440
tigr:DNO_1122 150 MQRIIASQISREKRLSLANFIIDNSNSIAq 179 Dichelobacter nodosus VCS1703A
Q5F691        154 VADIISHQASESERLLLADDVLLNDGSLKs 183 Neisseria gonorrhoeae FA 1090
Q56416        153 VLARERAQMPEEEKRKRATWVLEN-TGSLE 181 Thermus thermophilus HB8
Q03941        159 AKNRLNSQMSTEERMARSDYILQNNSTLVD 188 Saccharomyces cerevisiae S288C
P34558        166 AESRIHAQMDIEEKKKRAKIVIDNNGNIDE 195 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap