5AKD,4P7A


Conserved Protein Domain Family
DNA_mis_repair

?
pfam01119: DNA_mis_repair 
Click on image for an interactive view with Cn3D
DNA mismatch repair protein, C-terminal domain
This family represents the C-terminal domain of the mutL/hexB/PMS1 family. This domain has a ribosomal S5 domain 2-like fold.
Statistics
?
PSSM-Id: 307324
View PSSM: pfam01119
Aligned: 126 rows
Threshold Bit Score: 66.3585
Threshold Setting Gi: 74638071
Created: 15-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5AKD_D        233 GAILGTAFLEQALAIE--WQHGD--LTLRGWVADP-N-----HTTPAlAEIQYFYVNGRMMRDR-LINHAIRQAYE---- 297  Escherichia c...
Q7RPM0        220 YSIFGKKNIGNLIDFNi-TNEN---WLVKGYISDS-N-----SGRRD-KDLQFYYMNNRPIHVIkNVNKIINTIYR---- 284  Plasmodium yo...
Q4MZM5        218 EEIFGHEFAKKLVQINi-KDKE---WRIEGLVSNP-------YNERGyREMEYFYINKRPISKVqKFKNAISAIFS---- 282  Theileria parva
Q69L72        222 ITVFGLNTFKCLQPFNv-TISEG--CQVDGFLSKPgP-----GSGRNsGDRQFFYVNGRPVDMP-KVSKLVNELYR---- 288  Japanese rice
Q941I6        230 ITVFGISTFTSLQPVSi-CVSED--CRVEGFLSKPgQ-----GTGRNlADRQYFFINGRPVDMP-KVSKLVNELYK---- 296  thale cress
Q5FVX9        218 MSVVGSAIMNCMVPIQy-QSEDPk-IFINGYLPKP-YadnttTSLSS-SEKSFLFINRRPIYHK-EILKMVRWYHNqs-l 291  tropical claw...
XP_011986626  211 MSVLGTAVMGNMESFQyhCEESQ--IFLSGFLPKH-DadhscTSLST-PERSFIFINSRPVHQK-DILKLIRHYYNlk-c 284  sheep
CAG08289      214 AATLGPSVVMNLVPCH--HRQEQpeISLEGFFPKP-GadyssTSTSG-PDRTFTFVNNRPVHHK-DIMKLLRQHYTaqyp 288  spotted green...
XP_001641066  214 TGIIGANAMSSMEEIIv-KDDQTg-LRIEGFVPKP-GsdpnvTSRSM-GDRSFVYVNKRPVVLK-EIAQVVREFYLk--i 286  starlet sea a...
XP_001609336  219 GEIFGSNFIKNVLDIKl-TRDT---WSVEGIISTP-Q-----TGRQN-NDIQILFINRRPVDGMkKLKRCIKDVHK---- 283  Babesia bovis...
5AKD_D        298 DKLGADQQPAFVLYLEIDPHQVDVNVHPAKHEVRFHQSRLVHDFIYQGVLSVL 350  Escherichia coli K-12
Q7RPM0        285 -EFNSRLYPIIIFNILSDSKNIDINVTPDKREVFFTFENELCEEIKTELIKLL 336  Plasmodium yoelii yoelii
Q4MZM5        283 -HFSSKSKPSFILNLTMNYDHIDVNISPDKRSAYIYSEDYIIRTFKVSF---Y 331  Theileria parva
Q69L72        289 -SSNAKQYPVAVLNFCIPTTSYDVNVAPDKRKIFFSSEHAILLSLREGIENLY 340  Japanese rice
Q941I6        297 -DTSSRKYPVTILDFIVPGGACDLNVTPDKRKVFFSDETSVIGSLREGLNEIY 348  thale cress
Q5FVX9        292 NKGTPRCYPVFFMNIELPASCLDVNLTPDKTQIMLQNKEFVLHAVENVLRSVY 344  tropical clawed frog
XP_011986626  285 LKESTRLYPIFFLKIDVPTADVDVNLTPDKSQVLLQNKESVLIALENLMTTRy 337  sheep
CAG08289      289 ADGARSRYPILMLSVTVPPSAVDVNLTPDKTQVLLHDKEAVLTALEALLVSLY 341  spotted green pufferfish
XP_001641066  287 HPTISNRHPVAFLSIEVPPCAVDVNLEPNKSRVLLTEKDIIIDLLRNSLEELY 339  starlet sea anemone
XP_001609336  284 -QFSSKYNVAYVLNINIDSKHVDVNLAPDKRRLFLMQEDTITRQLKEGILELY 335  Babesia bovis T2Bo
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap