5US6,1ARZ,5UGJ,5KT0,3IJP,5EER,5WOL,1VM6,5UA0,3QY9,2CZC


Conserved Protein Domain Family
DapB_N

?
pfam01113: DapB_N 
Click on image for an interactive view with Cn3D
Dihydrodipicolinate reductase, N-terminus
Dihydrodipicolinate reductase (DapB) reduces the alpha,beta-unsaturated cyclic imine, dihydro-dipicolinate. This reaction is the second committed step in the biosynthesis of L-lysine and its precursor meso-diaminopimelate, which are critical for both protein and cell wall biosynthesis. The N-terminal domain of DapB binds the dinucleotide NADPH.
Statistics
?
Aligned: 109 rows
Threshold Bit Score: 74.9669
Threshold Setting Gi: 88192712
Created: 24-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5US6_A  27 VRIAVAGAaGRMGRNLVKAAHHnPVAKVAAGSERPEsslvgvdlgel-----------cgegkfdvvvcDDLAKQIDQ-- 93  Vibrio vulnificus CMCP6
Q8KBD8   1 MKITLVGn-GRMGRQIADVVAA-SGAHVVNRVLDV----------------------------------NDTIDAAAFsg 44  Chlorobaculum tepidum...
Q97GI8   2 VKILLNGCgGKMGTAITNLSNNyDNASISAGVDKFPksntg------------------------ypvfKSIAEVNVD-- 55  Clostridium acetobuty...
Q891S2   7 VRIMLVGCnGKMGRIITHCSKDfNDIEIVAGVDKSStsnld------------------------fpvfENIHSSSVE-- 60  Clostridium tetani E88
Q7UJD7   8 ISLTVHGAaGRMGRRVVALGLAdPNFQLVGAIDHAKsdhlgqdsgav-----------ageapsgieisSHWPVLDDAat 76  Rhodopirellula baltic...
B2I841   5 LRLLIHGAsGRMGQSLLRLASEdPSFQVTAAVVGNAphrhvsd-------------------gvpffaaAELAAVPA--- 62  Xylella fastidiosa M23
Q8P9L3   6 VKVLIHGAsGRMGKALLRLAAEdDALHVVGAVVGRSpsqrvvd-------------------gvpyfaaNELGGAPA--- 63  Xanthomonas campestri...
O80574  73 ISIMVNGCsGKMGKAVIKAADS-AGVNIVPI--SFGsagedgqrvevcg--------keitvhgptereKVLSSVFEKhp 141 thale cress
Q9V1P1   3 VKVGVNGY-GTIGKRVAYAITKqDDMELVGVVKTKPdfeayrakelgipvyaaneeflsrfesvgfeveGTLNDLLEK-- 79  Pyrococcus abyssi GE5
P46829   3 TRVALVGGtGKLGAIIAGVIDElDDFETVAVLGS-----------------------------------DERSREIDA-- 45  Mycobacterium tubercu...
5US6_A  94 FDVIIDFTAPASTLNNLALCQQY-GKSIVIGTTGFTEEQREQIDLVAQQ--VPVVMAPNY 150 Vibrio vulnificus CMCP6
Q8KBD8  45 SDVIIDFTVRSAFLANYPALIAS-GVPVVVGTTGW-DDVMPQVREEVVKarSTMLYSANY 102 Chlorobaculum tepidum TLS
Q97GI8  56 CDVILDFSRPDSLDEILKYSSQK-KLPIVLCTTGYTNEQIDKINEFSKS--HTVFRSANM 112 Clostridium acetobutylicum ATCC 824
Q891S2  61 CDVVLDFSRPSSLKSLISYCTEK-KLPLVLCTTGYSKEELNLIEETSKN--IPIFKSANM 117 Clostridium tetani E88
Q7UJD7  77 NQAVIDFSLPEAIDGCVEHCVKV-GSPLVVATTGLSDEQKQNLSEAAAS--IPVVWAPSM 133 Rhodopirellula baltica SH 1
B2I841  63 FDVAIDFSLPQGFSSLLALCVAR-AVPLVSGTTGLDSRQHEALVMAGAR--IPLVWGSNF 119 Xylella fastidiosa M23
Q8P9L3  64 FDVAIDFSLPQGFAPILALCVQR-GKPLVSGTTGLDEAQRAGLLQAAGQ--IPLVWASNF 120 Xanthomonas campestris pv. campestris str...
O80574 142 ELIVVDYTIPSAVNDNAELYSKV-GVPFVMGTTGGDRNKLYETVE-EAK--IYAVISPQM 197 thale cress
Q9V1P1  80 VDVIVDAT-PGGVGAKNKPLYEKaGVKAVF-----QGGEKANVAE------VSFVAQANY 127 Pyrococcus abyssi GE5
P46829  46 ADLVVDASTPGVSIDVVRAAIER-GKNVLVGTSGWSTERIALVRPLVEAagTGAVFIPNF 104 Mycobacterium tuberculosis variant bovis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap