1ARZ


Conserved Protein Domain Family
DapB_N

?
pfam01113: DapB_N 
Click on image for an interactive view with Cn3D
Dihydrodipicolinate reductase, N-terminus
Dihydrodipicolinate reductase (DapB) reduces the alpha,beta-unsaturated cyclic imine, dihydro-dipicolinate. This reaction is the second committed step in the biosynthesis of L-lysine and its precursor meso-diaminopimelate, which are critical for both protein and cell wall biosynthesis. The N-terminal domain of DapB binds the dinucleotide NADPH.
Statistics
?
PSSM-Id: 334389
View PSSM: pfam01113
Aligned: 99 rows
Threshold Bit Score: 71.1205
Threshold Setting Gi: 9910675
Created: 16-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1ARZ_A   6 IRVAIAGAgGRMGRQLIQAALAl-EGVQLGAALEREGssllgsdagelagagktgvtvqSSLDAVKDD--FDVFIDFTRP 82  Escherichia coli K-12
P94844   1 MKIGVYGAsGRIGKLLLEELKGgyKGLALSSVFVRQKcetdfssf-------shaplvtNDLKAFVRA--CECVIDFSLP 71  Helicobacter pylori 2...
Q6Q8U0   2 IKIMINGAsGKMGTKVSNLIKN--DSFLVECNDDISC---------------------------------SDLVIDFSHP 46  uncultured marine gam...
Q8RBI6   3 IRLIIHGCnGKMGKVVAKLAKEn-PEFEVVAGVDKNTfpld--------------fpvySDLKEVKEE--ADVVIDFSYH 65  Caldanaerobacter subt...
Q8XJ55   2 VKVILNGCsGKMGSVISNLAETkfPNVEIVAGIDNNTnaqrs-------------ypifAKPEDCNIS--YDVLLDFSRA 66  Clostridium perfringe...
Q97GI8   2 VKILLNGCgGKMGTAITNLSNNy-DNASISAGVDKFPksntg-------------ypvfKSIAEVNVD--CDVILDFSRP 65  Clostridium acetobuty...
Q891S2   7 VRIMLVGCnGKMGRIITHCSKDf-NDIEIVAGVDKSStsnld-------------fpvfENIHSSSVE--CDVVLDFSRP 70  Clostridium tetani E88
Q8F133   7 TQIALIGAsGRMGRAIVSVLSTs-VKSTLSSSVVSQSsvflgmdsglhsgikqngvnfsSDLEAAVRS--ADCVIDFSTH 83  Leptospira interrogan...
Q7UJD7   8 ISLTVHGAaGRMGRRVVALGLAd-PNFQLVGAIDHAKsdhlgqdsgavageapsgieisSHWPVLDDAatNQAVIDFSLP 86  Rhodopirellula baltic...
B2I841   5 LRLLIHGAsGRMGQSLLRLASEd-PSFQVTAAVVGNAphrhvsd--------gvpffaaAELAAVPA---FDVAIDFSLP 72  Xylella fastidiosa M23
1ARZ_A  83 EGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAADIAIVFAANF 129 Escherichia coli K-12
P94844  72 KGVDNLLEALLECPKILVSGTTGLEKETLEKMQQLALKAPLLHAHNM 118 Helicobacter pylori 26695
Q6Q8U0  47 SSTKKILKKCVAAKKPIIIGTTGFTNDDLNEIREAANSIPIVLAANM 93  uncultured marine gamma proteobacterium EBAC20E09
Q8RBI6  66 EAIPNLVKEAAKRKIPVVIATTGLSEEELKTVEEASKEIPIFRSANM 112 Caldanaerobacter subterraneus subsp. tengcongensis MB4
Q8XJ55  67 DALKSLVQFSKKTKKPLILCSTGYTAEDLKFIEESSKEIPLFRSANM 113 Clostridium perfringens str. 13
Q97GI8  66 DSLDEILKYSSQKKLPIVLCTTGYTNEQIDKINEFSKSHTVFRSANM 112 Clostridium acetobutylicum ATCC 824
Q891S2  71 SSLKSLISYCTEKKLPLVLCTTGYSKEELNLIEETSKNIPIFKSANM 117 Clostridium tetani E88
Q8F133  84 QNLDFTLKACIQYQKPVVIGITGLTELQKDALQVASKEIGIVYSPNM 130 Leptospira interrogans serovar Lai str. 56601
Q7UJD7  87 EAIDGCVEHCVKVGSPLVVATTGLSDEQKQNLSEAAASIPVVWAPSM 133 Rhodopirellula baltica SH 1
B2I841  73 QGFSSLLALCVARAVPLVSGTTGLDSRQHEALVMAGARIPLVWGSNF 119 Xylella fastidiosa M23
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap