5IT9


Conserved Protein Domain Family
Ribosomal_S6e

?
pfam01092: Ribosomal_S6e 
Click on image for an interactive view with Cn3D
Ribosomal protein S6e
Statistics
?
PSSM-Id: 334382
View PSSM: pfam01092
Aligned: 115 rows
Threshold Bit Score: 131.418
Threshold Setting Gi: 290987148
Created: 15-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5IT9_G         2 KLNISYPINGTQKCIEIdDEHRVRVFYDKRIGQEVDGESVGDEFKGYVFKIAGGNDKQGFPMKQGVLLPTRVKLLLAKGH 81  Kluyveromyces l...
Q18DP5         5 KVVVSD-ETGHTRQFEV-DEQDANRFLGRNLGNEVDGNAVG--LDGATLELTGGSDDAGRPMREDVSGSDLKELLLEG-G 79  Haloquadratum w...
Q9HMJ5         5 QVAVADPESGRTYQFEV-DGQDANRFIGREIGAAVDGGAVG--LDGYTVEITGGSDDAGRPMREDVDGSDLMEVLLEG-G 80  Halobacterium s...
XP_002670307  60 KFQLACRETGRTKLFEI-YGSGAEAFRGRKLGDEIDGSCIGNDFRDYIFKIRGASDHLGTCYTPGLIKYGTSCILRRPGE 138 Naegleria grube...
WP_009486829   5 QVVVADPESGRTYQREV-DGQDANRFLGLDIGDEVDGEAVG--LDGYTVEITGGSDAAGRPMRPDVDGAGLQDVLLSG-G 80  Halobacterium s...
WP_049953406   5 TVVVGDPDTGLAHQLEA-DGQDANRFLGKSIGDEVDGSAVG--LDGYTLEITGGSDDAGRPLNETVAGADLQEVLMEEKQ 81  Halostagnicola ...
AGB15190       5 NVVVGDPDSGLAYQLEA-DGQDANRFMGKSIGDEVDGGALG--LDGYTLEITGGSDETGRPLHAGVTGTSLTEVMMRESG 81  Halovivax ruber...
WP_015321542   5 TVVVGDPDSGSTYQLEA-DDQDANRFIGKSIGEEVDGTAVG--LDGYTLEITGGSDEAGRPLSPDVAGPNLEEVLMKGRQ 81  Natronococcus o...
BAJ47461       9 rMVLSDPVQKKASTIQL-TPQQLTLLIGKRIGETVDGGVFG--YKGYLIKITGGSDKDGFPMRPDVSGPRKVRVLLSG-G 84  Candidatus Cald...
WP_012309664  14 vLDIGDPSTGKTFHLKL-PKESLRYFIGKRIGEEISGDPFG--LPGYAFRITGGTDRDGFPMHPSLPTMGKKRLLLSS-P 89  Candidatus Kora...
5IT9_G        82 SCYR---PRR---------------NGERKRKSVRGAIVGPDLAVLALIITKKGEQEIEGITN 126 Kluyveromyces lactis
Q18DP5        80 VGYE---PTR---------------DGERKRITVRGRQVSDETAQVNAAVV--GETPIAVLlg 122 Haloquadratum walsbyi DSM 16790
Q9HMJ5        81 AGFN---PDE---------------DGERKRVTVRGKEVSEAVAQLNVAIDEHGEEPVAELLG 125 Halobacterium salinarum NRC-1
XP_002670307 139 FGYRgwqAKR---------------KGERRRIKLKGCILDRNLRAVSAIIIRKGALEIPGLTD 186 Naegleria gruberi strain NEG-M
WP_009486829  81 PGFK---PTT---------------DGERKRVSVRGKEVSDATVQLNVAVAERGDESVASLYG 125 Halobacterium sp. DL1
WP_049953406  82 TGYH---PKR---------------DGERRRITVRGREVSDAVAQINASIVEAGDTDVDELLA 126 Halostagnicola larsenii
AGB15190      82 TGYH---QRR---------------GGERRRVTVRGREIADDVSQINATVTESGSTAIDELLG 126 Halovivax ruber XH-70
WP_015321542  82 VGYH---PTR---------------DGERRRVTVRGREVSDAVAQINASVVESGSSDIDELLG 126 Natronococcus occultus
BAJ47461      85 PGFH---PRRkpaskrkkkrarrlvKGLRKRVTVRGDTISEAIAQINAILVKKGEQDVAG--- 141 Candidatus Caldiarchaeum subterr...
WP_012309664  90 PGFH---PKR---------------EGERRAKLVRGSVISDAMRQINLKVIKKGDKPLEEILG 134 Candidatus Korarchaeum cryptofilum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap