5A63


Conserved Protein Domain Family
Presenilin

?
pfam01080: Presenilin 
Click on image for an interactive view with Cn3D
Presenilin
Mutations in presenilin-1 are a major cause of early onset Alzheimer's disease. It has been found that presenilin-1 binds to beta-catenin in-vivo. This family also contains SPE proteins from C.elegans.
Statistics
?
PSSM-Id: 334376
View PSSM: pfam01080
Aligned: 58 rows
Threshold Bit Score: 270.629
Threshold Setting Gi: 1002257179
Created: 16-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5A63_B         76 KYGAKHVIMLFVPVTLCMVVVVATIKSVs-------fYT--RKD----------GQ-LIYTPFTE---DTETVGQRALHS 132
gi 401112      11 LVRSSQLRWTLFSVIANMSLTLSIWIGV---------YNmeVNS----------ELsKTYFLDPS---FEQTTGNLLLDG 68
gi 341901755    9 VRRSAQLQWTLFSVIANMSLTLSIWIGI---------YRmeVNS----------ELsKMYFLDDS---FNWTTGSPTLDG 66
gi 268560578    9 LRRSSQLQWTLFSVVVNMSLTLAIWIGI---------YHmeVNS----------ELsKMYFLDDS---FNWTTGNPALDG 66
gi 308469192    9 FRRSSQLQWTLFSVIVNMSLTLSIWIGI---------YQmqVNS----------ELsKLYFLDDS---FERTTGNTTLDG 66
gi 1002257179  27 dslGEDITRIVTPVSTCMLLVVLLVSLL----------SspSSPspf-----taAFsAAAG--------PGGGGDDITTA 83
gi 357130900   21 dtlGEEVLAVMSPVSICMALVVLLISIL----------SppSSPaspsapppvtAAtLVYLES-----PSDSPGQKLVGA 85
gi 123494674   12 eFYARKVAKIAVPVVLTLILDAVCIRFIerthgsaelNRnfVDTm-----------------------SRNDSGISVTAS 68
gi 123385143   12 eIYSKRIYKIAVPVILTLVIDVWLTRTLeekfdntalSTsfASVv-----------------------SQSSGGVSTAVA 68
gi 299117501   63 AYSANSFMAVVKPVTLCMTLSAFITVSL---------YSdaEGAt--------nSAlSVYEVYDEsttTLDPSSVRLGKS 125
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5A63_B        133 ILNAAIMISVIVVMTILLVVLYKYRCYKVIHAWLIISSLLLLFFFSFIYLGEVFKTY-------NVAVDYITVALLIWNF 205
gi 401112      69 FINGVGTILVLGCVSFIMLAFVLFDFRRIVKAWLTLSCLLILFGVSAQTLHDMFSQVfdqddnnQYYMTIVLIVVPTVVY 148
gi 341901755   67 LINGFCTILVLGGVSFIMLAFVLYDFRRIVKLWLTFSCILILFGVSGQTIYDLFVQVfdqndenGFLMTVFCTVIPTVVY 146
gi 268560578   67 LINGFCTILVLGCVSFVMLAFVLYDFRRIVKSWLTFSCLLILFGVSGQTIYDLFSQIfdqndenQFILTVALTVIPTVVY 146
gi 308469192   67 LINGFATILVLGCVSFVMLAFVLYDFQRVVKAWLTLSCMLILFGVSGQTLYDLFTQIldqndenQYILTVALTVIPTTIY 146
gi 1002257179  84 LITAVTFVVAVTAATFLLAFLFYLRCTPCLRAYLGFSSLSVLLLLGGHVALLLLSRL-------RLPLDAASFALLLPNA 156
gi 357130900   86 LLDAAVFVALVAVVTFVLVALYYYRCTGFLKNYMRFSAFFVLFSMGGAIAITILRRL-------DVPLDAPTALLLLFNA 158
gi 123494674   69 IWSAVGIIFMIIVVTAILLTLYYFGCMKIIFGWLILAVSLLLSMYFLVGFGTYPSIV-------NIPVDYLSLAVFLLNL 141
gi 123385143   69 IYIAIGFIVAIALVTGLLLLLYWFNCVKCIYVWMVVAVSLLLSYYVYLAVGKIPSLY-------NIPIDYIAVVIFLLNG 141
gi 299117501  126 FVNALIIVLVLAAATFVIVWMYWMRCMRCLVGYMAMSSAVLLGVMGGAVWAAALEVY-------QLPCDAFTYYGVLWNF 198
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5A63_B        206 G-VVGMISIHW--KGPLRLQQAYLIMISALMALVFIKyLPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETL 282
gi 401112     149 G-FGGIYAFFS--NSSLILHQIFVVTNCSLISVFYLRvFPSKTTWFVLWIVLFWDLFAVLAPMGPLKKVQEKASDYSKCV 225
gi 341901755  147 G-CLGIYAFLA--NGSLLLHQFFVVSNCSLISVFYLRaFPRYTTWFVLWTVLFWDLFAVLAPMGPLKKVQEKASDYSNNI 223
gi 268560578  147 G-CLGIYAFLA--NGSLLLHQFFVVSNCSLIAVFYLRaFPKHTTWFVLWTVLFWDLFAVLAPMGPLKKVQEKASDYSNNI 223
gi 308469192  147 G-VLGIYAFFA--NGSLALHQFFVISNCSLISVFYLRaFPRYTTWFVLWMVLFWDLFAVLAPMGPLKKVQEKASDYSNNI 223
gi 1002257179 157 AaALALAALSPa-SVPIALHQAALVAIAVLTAFWFTL-LPEWTTWALLVAMAVYDLAAVLLPGGPLRLLLELAIERNEEI 234
gi 357130900  159 S-AVGVLSVFAs-AVPILVRQGYMVTLAVIVAAWLSR-LPEWTTWIMLVALAVYDLVAVLAPRGPLRMLVELASSRDDEL 235
gi 123494674  142 V-VVGNMSIFW--RAPQRITQAFLVLISILTSIVFRY-LPDWTVWILLVLLIIYDACVVLCPNGLLILLLKKSEERGDAI 217
gi 123385143  142 V-VVGGMSIFW--RAPPIVTQAFMIWISVMTACVFLT-LPDWTVWILLVLLIIWDCCVVLCPNGLLHLLIKKSQERGDAI 217
gi 299117501  199 A-VVGVVAIFYqkGIPTVVTQAYLVATSIIMAWQLSR-FEEWTGWCLLVVLALYDLCAVLTPCGPLKALVNLMQEYEEPM 276
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5A63_B        283 fPALIYSSTMVWLvn-----------mAEGDPEAQRRVSKNSKYNAESTERE----------------------S----- 324
gi 401112     226 lNLIMFSANEKRLtagsnq---eetneGEESTIRRTVKQTIEYYTKREAQDD----------------------Efyqki 280
gi 341901755  224 lKFLMFAAENKRAsagmdml-egseepNEERKIRQNVSQLIQMYSKKEEKDD----------------------Eflqki 280
gi 268560578  224 lKILMFAAEDKREsagmdmaqdsqenlNDERKLRKDVKELIQLYSKQDEKDD----------------------Eflqki 281
gi 308469192  224 lKFLMFAAEDKREtagidatedssenlNDERKLRKDVKQLIELYSKKEAQDD----------------------Eflrki 281
gi 1002257179 235 -PALVYEARPVDPrhghnwrlwrertqSGAELDANSTVEVLGEVLGTNLGAS----------------------Sagnlg 291
gi 357130900  236 -PALIYESRPTVGpaersssyapamwsEEMQLPADSARSGVNQYERAGQQDNlgsamvemrdlggsrsrvhqttSssgsm 314
gi 123494674  218 -PALLYSAAAWEEadpekgnqnneegdGNEGNQEDPAEQADNQDNNEEEEEE----------------------Eeaenn 274
gi 123385143  218 -PALVYSSAAFFWkeadd-----geeqNEEGEDHENLDNYDEEYDSASEDES----------------------Tdpdss 269
gi 299117501  277 -PGLLYEAELPAGpprrrrpendrrapSQQQARREQPGATGGPQEGDVSSSP----------------------Rapvgt 333
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5A63_B        325 -QDTVaenddg---------------------gfseewEAQRDSHLGP-HRSTPES------RAAVQELSSSilag---- 371
gi 401112     281 rQRRAainpdsvptehsplv---eaepspielkeknstEELSDDESDTsETSSGSS------NLSSSDSSTTvstsdist 351
gi 341901755  281 rQRRTainpdsgltghsplvhtqpspttplrlkehnsdVEHTDDESDTtESSSSSS--------SSGEVSTEvsssevst 352
gi 268560578  282 rQRRNainpdsgstahspmv---ttepspivlkeknsdEELFDNESDTtESSSESS--------TSSESVfsssdvstaa 350
gi 308469192  282 rQRRTainpdsaltetspvht--epsdaliqlksknsdEEHTDDESDTtESSTTTS---------SSDvttsevstaeev 350
gi 1002257179 292 vSAIRsdervglagdarnlr----lgtsmpnlssdsasAQVEVLPASPeISVSVPEmrvpliQPRPERTRDEeddedgi- 366
gi 357130900  315 lQMGNleagqisnqggsa--------qhaviqieqpeeEERAPLVSAAsANSAVAN------EEHRQISSSDppdedfe- 379
gi 123494674  275 ----------------------------------qpqeNANGEAQNGNqNNNKKKK------NMSKRDNE---------- 304
gi 123385143  270 aSSDDalpinpdefvglsn-----npedqpppqpkpeqQPESELAQPAgEPTKPKK------KRPNQDNQHGdpenpdkr 338
gi 299117501  334 aTMGGggladlagggd------------eeggrgaddeTPAAPVSAEAaAVVEPQS------SSPGGDHSSArrpgadsa 395
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5A63_B            --------------------------------------------------------------------------------
gi 401112     352 aeec---------------------------------------------------------------------------- 355
gi 341901755  353 adec---------------------------------------------------------------------------- 356
gi 268560578  351 eca----------------------------------------------------------------------------- 353
gi 308469192  351 ap------------------------------------------------------------------------------ 352
gi 1002257179     --------------------------------------------------------------------------------
gi 357130900      --------------------------------------------------------------------------------
gi 123494674      --------------------------------------------------------------------------------
gi 123385143  339 kkk----------------------------------------------------------------------------- 341
gi 299117501  396 gasesvaapllelvesgtaavavgdasadgsgtrsgreqgkrrlatvrrgirgggcldpeppgwrtvqaekklelfspvp 475
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5A63_B        372 -----------edpEEr---------------------------------GVKLGLGDFIFYSVLVGKASAtasGDWNTT 407
gi 401112     356 --dqkewddlvsnsLPnndkrpata-----------------adalndgeVLRLGFGDFVFYSLLIGQAAAs--GCPFAV 414
gi 341901755  357 ---apeewnqlvqeVVpeakaqvta-----------------adalndgeTVRLGFGDFVFYSLLIGQAATg--GCPVAV 414
gi 268560578  354 --peewnelihqqnEFdqndatvtaadalndgvksknsgrlfseicrfpeTVRLGFGDFVFYSLLIGQAATg--GCPISV 429
gi 308469192  353 eewnelmeqqekqaEFdqryvpvta-----------------adalndgeTVRLGFGDFVFYSLLIGQTATg--GSALAV 413
gi 1002257179 367 --------------------------------------------glsssgAIKLGLGDFIFYSVLVGRAAM---YDYMTV 399
gi 357130900  380 --------------------------------------------mfesskGIKLGLGDFVFYSVLVGRAAM---YDLMTV 412
gi 123494674  305 --------------------------------------------------GIKLGLGDFVFYGILVSRAAR---IGWDIT 331
gi 123385143  342 ---------------------------------------sgsakstptseGVKLGLGDFIFYGILVTRAAR---VGWDIA 379
gi 299117501  476 tssraaaaaendedEEem------------------------------gvSIKLGLGDFVFYSVLVSKAAL---YGFTAW 522
                         570       580       590       600       610
                  ....*....|....*....|....*....|....*....|....*....|
5A63_B        408 IACFVAILIGLCLTLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFM 457
gi 401112     415 ISAALGILFGLVVTLTVFSTEESTTPALPLPVICGTFCYFSSMFFWEQLY 464
gi 341901755  415 ALAAFGILFGLIVTLTVLSNDESTTPALPVPVICGTFCYFISKLVMDQFY 464
gi 268560578  430 GFAAFGILFGLIATLTVLSSEESTTPALPLPVICGTFCYFVSRFLVDSiq 479
gi 308469192  414 ACSALGILFGLVATLTVFSSGESTTPALPLPVICGTFCYFISKFVVDQVY 463
gi 1002257179 400 YACYLAIIAGLGITLLLLAFYRKALPALPVSIALGVVFYVLTRTLLETFV 449
gi 357130900  413 YACYLAIIAGLGCTLILLSICRHALPALPISIMLGVVFYFLTRLLMEPFV 462
gi 123494674  332 ILCIFAVILGLSLTLVCLAVWERPLPALPFSLALGIVFFIIGAMTFRQFC 381
gi 123385143  380 ILDILAVMDGLALTLICLAYFERPLPALPFSLALGIIFYLIGAYTFRGFs 429
gi 299117501  523 AACVVVIVFGLGATLVLLAVYRMALPALPISIGFGTVFYLLTRFSIQPYV 572
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap