5A63


Conserved Protein Domain Family
Presenilin

?
pfam01080: Presenilin 
Click on image for an interactive view with Cn3D
Presenilin
Mutations in presenilin-1 are a major cause of early onset Alzheimer's disease. It has been found that presenilin-1 binds to beta-catenin in-vivo. This family also contains SPE proteins from C.elegans.
Statistics
?
Aligned: 63 rows
Threshold Bit Score: 256.765
Threshold Setting Gi: 1002257179
Created: 24-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5A63_B         76 KYGAKHVIMLFVPVTLCMVVVVATIKSVs-------fYT--RKD-----GQ-LIYTPFTE---DTETVGQRALHSILNAA 137 human
EAX86148       12 eIYSKRIYKIAVPVILTLVIDVWLTRTLeekfdntalSTsfASVv------------------SQSSGGVSTAVAIYIAI 73  Trichomonas va...
EAY14349       12 eFYARKVAKIAVPVVLTLILDAVCIRFIerthgsaelNRnfVDTm------------------SRNDSGISVTASIWSAV 73  Trichomonas va...
1_pfamImport    1 LNRSSQLKWTLFSVIVNMLLTLSVWIGV---------YGmeVNS-----ELsRLYFLDTA---SNSTTGNPVLDGAINGM 63 
Q01608         11 LVRSSQLRWTLFSVIANMSLTLSIWIGV---------YNmeVNS-----ELsKTYFLDPS---FEQTTGNLLLDGFINGV 73  Caenorhabditis...
EFO85358        9 FRRSSQLQWTLFSVIVNMSLTLSIWIGI---------YQmqVNS-----ELsKLYFLDDS---FERTTGNTTLDGLINGF 71  Caenorhabditis...
CAP30997        9 LRRSSQLQWTLFSVVVNMSLTLAIWIGI---------YHmeVNS-----ELsKMYFLDDS---FNWTTGNPALDGLINGF 71  Caenorhabditis...
XP_015632905   27 dslGEDITRIVTPVSTCMLLVVLLVSLL----------SspSSPspftaAFsAAAG--------PGGGGDDITTALITAV 88  Japanese rice
13_pfamImport   1 MHGINSFWAIVFPVCVTMIIASLAVVNYr--------NSsiEASm----QTyLVYGSS-----DQDSGAQQLGMSLVNAV 63 
CBN74004       63 AYSANSFMAVVKPVTLCMTLSAFITVSL---------YSdaEGAt---nSAlSVYEVYDEsttTLDPSSVRLGKSFVNAL 130 Ectocarpus sil...
5A63_B        138 IMISVIVVMTILLVVLYKYRCYKVIHAWLIISSLLLLFFFSFIYLGEVFKTY-------NVAVDYITVALLIWNFG-VVG 209 human
EAX86148       74 GFIVAIALVTGLLLLLYWFNCVKCIYVWMVVAVSLLLSYYVYLAVGKIPSLY-------NIPIDYIAVVIFLLNGV-VVG 145 Trichomonas va...
EAY14349       74 GIIFMIIVVTAILLTLYYFGCMKIIFGWLILAVSLLLSMYFLVGFGTYPSIV-------NIPVDYLSLAVFLLNLV-VVG 145 Trichomonas va...
1_pfamImport   64 FTIVVLGIVSFVMLGFVLYDFQNLVKTWLIFSCLLILFGVSGQTFYDLFSQLvdqetenGRNLTLVLTILPTLVYG-LAG 142
Q01608         74 GTILVLGCVSFIMLAFVLFDFRRIVKAWLTLSCLLILFGVSAQTLHDMFSQVfdqddnnQYYMTIVLIVVPTVVYG-FGG 152 Caenorhabditis...
EFO85358       72 ATILVLGCVSFVMLAFVLYDFQRVVKAWLTLSCMLILFGVSGQTLYDLFTQIldqndenQYILTVALTVIPTTIYG-VLG 150 Caenorhabditis...
CAP30997       72 CTILVLGCVSFVMLAFVLYDFRRIVKSWLTFSCLLILFGVSGQTIYDLFSQIfdqndenQFILTVALTVIPTVVYG-CLG 150 Caenorhabditis...
XP_015632905   89 TFVVAVTAATFLLAFLFYLRCTPCLRAYLGFSSLSVLLLLGGHVALLLLSRL-------RLPLDAASFALLLPNAAaALA 161 Japanese rice
13_pfamImport  64 VIIGAIAVLTFGMALLYKYNCMKFLGGYIMFASTAILSFVGGQLVDSIVNDQl------GWPVDWITFLFVMINFG-FVG 136
CBN74004      131 IIVLVLAAATFVIVWMYWMRCMRCLVGYMAMSSAVLLGVMGGAVWAAALEVY-------QLPCDAFTYYGVLWNFA-VVG 202 Ectocarpus sil...
5A63_B        210 MISIHW--KGPLRLQQAYLIMISALMALVFIKyLPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLfPALI 287 human
EAX86148      146 GMSIFW--RAPPIVTQAFMIWISVMTACVFLT-LPDWTVWILLVLLIIWDCCVVLCPNGLLHLLIKKSQERGDAI-PALV 221 Trichomonas va...
EAY14349      146 NMSIFW--RAPQRITQAFLVLISILTSIVFRY-LPDWTVWILLVLLIIYDACVVLCPNGLLILLLKKSEERGDAI-PALL 221 Trichomonas va...
1_pfamImport  143 IVAFLA--NGSLLLHQCFVVSNCSLIAVFYLRaFPRHTTWFVLFIVLFWDLFAVLTPMGPLKRVQEKASDYSNNIlKFLM 220
Q01608        153 IYAFFS--NSSLILHQIFVVTNCSLISVFYLRvFPSKTTWFVLWIVLFWDLFAVLAPMGPLKKVQEKASDYSKCVlNLIM 230 Caenorhabditis...
EFO85358      151 IYAFFA--NGSLALHQFFVISNCSLISVFYLRaFPRYTTWFVLWMVLFWDLFAVLAPMGPLKKVQEKASDYSNNIlKFLM 228 Caenorhabditis...
CAP30997      151 IYAFLA--NGSLLLHQFFVVSNCSLIAVFYLRaFPKHTTWFVLWTVLFWDLFAVLAPMGPLKKVQEKASDYSNNIlKILM 228 Caenorhabditis...
XP_015632905  162 LAALSPa-SVPIALHQAALVAIAVLTAFWFTL-LPEWTTWALLVAMAVYDLAAVLLPGGPLRLLLELAIERNEEI-PALV 238 Japanese rice
13_pfamImport 137 VISIFYqkGTPKFVQNGYLVLVSVILAWEFSM-WPMWTTITFCFMFAIYDLCAVLTPCGPLKCLINLIQEKQAPL-PGLL 214
CBN74004      203 VVAIFYqkGIPTVVTQAYLVATSIIMAWQLSR-FEEWTGWCLLVVLALYDLCAVLTPCGPLKALVNLMQEYEEPM-PGLL 280 Ectocarpus sil...
5A63_B        288 YSSTMVWl-----------VNMAEGDPEAQRRVSKNSKYNAESTERES------QDTVaenddg---------------- 334 human
EAX86148      222 YSSAAFFwkea-----ddgEEQNEEGEDHENLDNYDEEYDSASEDESTdpdssaSSDDalpinpdefvglsn-----npe 291 Trichomonas va...
EAY14349      222 YSAAAWEeadpekgnqnneEGDGNEGNQEDPAEQADNQDNNEEEEEEEeaenn--------------------------- 274 Trichomonas va...
1_pfamImport  221 FAADDNRqsagad---raeevnEGDGTIRRGVKQLIAMYSKQEAQDEEfaqkirQRRSawnpdsglteqsplvetepsps 297
Q01608        231 FSANEKRltagsn---qeetneGEESTIRRTVKQTIEYYTKREAQDDEfyqkirQRRAainpdsvptehsplv---eaep 304 Caenorhabditis...
EFO85358      229 FAAEDKRetagidatedssENLNDERKLRKDVKQLIELYSKKEAQDDEflrkirQRRTainpdsaltetspvht--epsd 306 Caenorhabditis...
CAP30997      229 FAAEDKResagmdmaqdsqENLNDERKLRKDVKELIQLYSKQDEKDDEflqkirQRRNainpdsgstahspmv---ttep 305 Caenorhabditis...
XP_015632905  239 YEARPVDprhghnwrlwreRTQSGAELDANSTVEVLGEVLGTNLGASSagnlgvSAIRsdervglagdarnlr----lgt 314 Japanese rice
13_pfamImport 215 YEADVRDgvtnqphqqpaaAAPRARKSPRPAAATASSSSLGEASQSSSsvhasgNSSSsss------------------- 275
CBN74004      281 YEAELPAgpprrrrpendrRAPSQQQARREQPGATGGPQEGDVSSSPRapvgtaTMGGggladlagggd----------- 349 Ectocarpus sil...
5A63_B        335 -----gfseewEAQRDSHLGP-HRSTPES------RAAVQELsssilag------------------------------- 371 human
EAX86148      292 dqpppqpkpeqQPESELAQPAgEPTKPKK------KRPNQDNqhgdpenpdkrkk------------------------- 340 Trichomonas va...
EAY14349      275 -------qpqeNANGEAQNGNqNNNKKKK------NMSKRDNe------------------------------------- 304 Trichomonas va...
1_pfamImport  298 vptehqqeekeDKQMDSESSSeSCSESAS-------IASGDSnaddkekeeeddeyqssnietaeecdmet--------- 361
Q01608        305 spielkeknstEELSDDESDTsETSSGSS------NLSSSDSsttvstsdistaeecdqkewddl--------------- 363 Caenorhabditis...
EFO85358      307 aliqlksknsdEEHTDDESDTtESSTTTS---------SSDvttsevstaeevapeewnelmeqq--------------- 362 Caenorhabditis...
CAP30997      306 spivlkeknsdEELFDNESDTtESSSESS--------TSSESvfsssdvstaaecapeewnelihqqnefdqn------- 370 Caenorhabditis...
XP_015632905  315 smpnlssdsasAQVEVLPASPeISVSVPEmrvpliQPRPERTrdeedded------------------------------ 364 Japanese rice
13_pfamImport 276 --------nhqRAARPTPAPIqPRPAPVA------PAASSDLatvtenfnrprnvmesdfstydcetmdaliellanfyr 341
CBN74004      350 -eeggrgaddeTPAAPVSAEAaAVVEPQS------SSPGGDHssarrpgadsagasesvaapllelvesgtaavavgdas 422 Ectocarpus sil...
5A63_B        372 -------------------------------------------------------------------edpeerGVKLGLG 384 human
EAX86148      341 -------------------------------------------------------------ksgsakstptseGVKLGLG 359 Trichomonas va...
EAY14349      305 -------------------------------------------------------------------------GIKLGLG 311 Trichomonas va...
1_pfamImport  362 --------------------------------------------wqqlvneanakqgdnksnltaadalndgeTVRLGFG 397
Q01608        364 --------------------------------------------------vsnslpnndkrpataadalndgeVLRLGFG 393 Caenorhabditis...
EFO85358      363 --------------------------------------------------ekqaefdqryvpvtaadalndgeTVRLGFG 392 Caenorhabditis...
CAP30997      371 ------------------------------------------datvtaadalndgvksknsgrlfseicrfpeTVRLGFG 408 Caenorhabditis...
XP_015632905  365 -----------------------------------------------------------------giglsssgAIKLGLG 379 Japanese rice
13_pfamImport 342 tfspedvwkapqv---------aekffatqdrlwllifhkyrvcscsieipcavqarqdakrraaeeeddddkTIKLGLG 412
CBN74004      423 adgsgtrsgreqgkrrlatvrrgirgggcldpeppgwrtvqaekklelfspvptssraaaaaendedeeemgvSIKLGLG 502 Ectocarpus sil...
5A63_B        385 DFIFYSVLVGKASAtasGDWNTTIACFVAILIGLCLTLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFM 457 human
EAX86148      360 DFIFYGILVTRAAR---VGWDIAILDILAVMDGLALTLICLAYFERPLPALPFSLALGIIFYLIGAYTFRGFs 429 Trichomonas vaginalis G3
EAY14349      312 DFVFYGILVSRAAR---IGWDITILCIFAVILGLSLTLVCLAVWERPLPALPFSLALGIVFFIIGAMTFRQFC 381 Trichomonas vaginalis G3
1_pfamImport  398 DFVFYSLLIGQAAAs--GCPIAVVFAAAGILFGLLVTLTVLSTEESTTPALPVPVLCGTFCYFTSKFVWENL- 467
Q01608        394 DFVFYSLLIGQAAAs--GCPFAVISAALGILFGLVVTLTVFSTEESTTPALPLPVICGTFCYFSSMFFWEQLY 464 Caenorhabditis elegans
EFO85358      393 DFVFYSLLIGQTATg--GSALAVACSALGILFGLVATLTVFSSGESTTPALPLPVICGTFCYFISKFVVDQVY 463 Caenorhabditis remanei
CAP30997      409 DFVFYSLLIGQAATg--GCPISVGFAAFGILFGLIATLTVLSSEESTTPALPLPVICGTFCYFVSRFLVDSiq 479 Caenorhabditis briggsae
XP_015632905  380 DFIFYSVLVGRAAM---YDYMTVYACYLAIIAGLGITLLLLAFYRKALPALPVSIALGVVFYVLTRTLLETFV 449 Japanese rice
13_pfamImport 413 DFIFYSVLVGRAAI---YDFSTFAATFICIVMGLGGTLFLLAVLHKALPALPISIFLATFFYFWTYYLFVDFC 482
CBN74004      503 DFVFYSVLVSKAAL---YGFTAWAACVVVIVFGLGATLVLLAVYRMALPALPISIGFGTVFYLLTRFSIQPYV 572 Ectocarpus siliculosus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap