Conserved Protein Domain Family
Mg_chelatase

?
pfam01078: Mg_chelatase 
Magnesium chelatase, subunit ChlI
Magnesium-chelatase is a three-component enzyme that catalyzes the insertion of Mg2+ into protoporphyrin IX. This is the first unique step in the synthesis of (bacterio)chlorophyll. Due to this, it is thought that Mg-chelatase has an important role in channelling inter- mediates into the (bacterio)chlorophyll branch in response to conditions suitable for photosynthetic growth. ChlI and BchD have molecular weight between 38-42 kDa.
Statistics
?
PSSM-Id: 307292
View PSSM: pfam01078
Aligned: 53 rows
Threshold Bit Score: 239.354
Threshold Setting Gi: 81829195
Created: 14-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5QZ88 192 DLADVVGQEQAKRALLLSAAGKHHLLFVGPPGTGKTMLAQRLNGILPPLTEQEAMEIAAVKSVSF-DYHHAEALTRRELR 270 Idiomarina loihiensis
Q5YS50 190 DLSEVVGQEEARWALEVAAAGGHHLLLTGPPGIGKTMLAQRLPSLLPPLTEAESLEVTAIHSMAGaLSGEHPLVTTPPFV 269 Nocardia farcinica
P9WPR1 190 DLADVVGQSQARFAVEVAAAGAHHLMLTGPPGVGKTMLAQRLPGLLPSLSGSESLEVTAIHSVAGlLSGDTPLITRPPFV 269 Mycobacterium tubercu...
Q8G5R8 200 DMNEVLGQEHAKWALQVAAAGGHNLIMTGPPGSGKTMLASRMPGIMCPLNEAEQLEVASIRSLCG-ILPQYGITDMPPFE 278 Bifidobacterium longum
Q6AEA9 192 DMSDIAGNEEAVEALVVAAAGGHNVTMIGLPGAGKTMLARRLPSLLPDLTPDQALETTSIRSLAG-VGTVGGLIHRPPFE 270 Leifsonia xyli subsp....
Q83MV2 193 DLSDISGNQLGIEALQIAAAGGHNLFFYGPAGSGKTMLASRLPALLPDLSPQASLEVSSVVSLSG-TGLKDGLITRPPFE 271 Tropheryma whipplei s...
Q6NGK1 201 DMQDVVGQSDAKKAAEIAVAGGHNIVMIGPPGSGKSMIAQRMAGLLPALTHTEMIEATAIHSVMG--QAFNGPMTHPPFV 278 Corynebacterium dipht...
Q8NNZ7 192 DMRDVVGQPEARFAAEVAAAGGHHMLMIGPPGSGKSMIAERIPSLLPELSPQQMIEATAVHSVVG--RTFSGPVSRAPFI 269 Corynebacterium gluta...
Q8FP67 192 DMRDVVGQPEARFAAEVAAAGGHHMMMLGPPGSGKSMIAQRLPGLLPPLDEQQRIEATVVHSVAG--RTFNGAVLRAPFV 269 Corynebacterium effic...
Q6A7T6 175 DLTEVIGQHEARRALEVAAAGRHHILLRGAPGCGKSMLARRLPGILPRLDHRDALEVTALHSLAG--RGSGRLMTRPPLA 252 Propionibacterium acnes
Q5QZ88 271 NPHHTCTAAALVGGgaGN-SVRPGEISLANNGLLFLDEMPEFSRHVLDCLREPLGSGEITISRAGYNVKFPANFQLVCAL 349 Idiomarina loihiensis
Q5YS50 270 APHHSTSVTAMIGG--GSgTARPGAVSRAHRGVLFLDECAEIGTKVLEAMRTPLEEGEVRIARRDGVARYPARFQLVLAA 347 Nocardia farcinica
P9WPR1 270 APHHSSSVAALVGG--GSgMARPGAVSRAHRGVLFLDECAEISLSALEALRTPLEDGEIRLARRDGVACYPARFQLVLAA 347 Mycobacterium tubercu...
Q8G5R8 279 APHHTASTAALVGG--GSgIAVPGAITRAHRGILFLDEAPEFSARALQTLREPLESGYVALSRSKGSTYYPASFQLIMAA 356 Bifidobacterium longum
Q6AEA9 271 SPRHTASAVALVGG--GSgRITPGAVVRATNGVLFLDEAAEFPAAVLDVLRQPLESGTITIHRASGAATYPARFQLVLAA 348 Leifsonia xyli subsp....
Q83MV2 272 APHHSITASALVGG--GAkRIIPGAVSRASHGVLFLDEAPEFSPRVLNMLRQPLETGQISIHRSTTTATFPATFQLILAA 349 Tropheryma whipplei s...
Q6NGK1 279 APHHSITKAALLGG--GSgNLQPGAASLAHTGVLFLDEVSEIPANILDCLRMPLECGEIKLMRHRREVTFPARFQLVMAT 356 Corynebacterium dipht...
Q8NNZ7 270 SPHHNVSKAALLGG--GSgSPLPGAISLAHHGVLFLDEVSEIPASILDSLRTPLEYGSIRIIRSRHDVTFPAQFQLILAA 347 Corynebacterium gluta...
Q8FP67 270 APHHSVSRAALLGG--GSgNPMPGAVSLAHHGVLFLDEVSEIPASTLDTLRTPLECGSVRIVRSRQDITFPARFQLVMAA 347 Corynebacterium effic...
Q6A7T6 253 QPHHSVSMAAMVGG--GVrIAQPGAISLAHRGVLFLDEAPEFAPKVLDSLRGPLETGEIVIGRSQAHTTFPARFQLVMAL 330 Propionibacterium acnes
Q5QZ88 350 NPSPCGQFDGSLANCRSTPDQILKYLSKLSGPLLDRIDIQVMVpRESESMSL 401 Idiomarina loihiensis
Q5YS50 348 NPCPCAPARDVD--CICPPLARRRYLGKLSGPLMDRIDLWVRM-HGHTGPAL 396 Nocardia farcinica
P9WPR1 348 NPCPCAPAD--PQDCICAAATKRRYLGKLSGPLLDRVDLRVQM-HRLRAgaf 396 Mycobacterium tuberculosis H37Rv
Q8G5R8 357 NPCPCGYYYGTGERCACREKDRIRYFSRLSGPILDRVDIQMAV-PPVSRIAA 407 Bifidobacterium longum
Q6AEA9 349 NPCPCGQYGSAEEECVCPPAARRCYLARLSGPLLDRVDLRLTV-RRLGLGAL 399 Leifsonia xyli subsp. xyli
Q83MV2 350 NPCPCGNFGIKDAECVCSSSARRKYMGRIHRPIIDRIDIQLMI-NRISIAEl 400 Tropheryma whipplei str. Twist
Q6NGK1 357 NPCRCA--AELPSECRCSATTRARYLSNISGPLRDRLDIFVRT--HAQGAVI 404 Corynebacterium diphtheriae
Q8NNZ7 348 NPCRCG--AEQPQECVCSGSARATYLNNLSGPLRDRLDMVVAT--HSKGAVL 395 Corynebacterium glutamicum
Q8FP67 348 NPCRCG--AEQPTECTCTGAARASYLTNLSGPLRDRLDLVVRT--HAKGSVL 395 Corynebacterium efficiens
Q6A7T6 331 NPCPCGLADDPSGRCTCTPQQVRRYSGRLSGPILDRVDVTVRMrPLTSAHLL 382 Propionibacterium acnes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap