6BFG,2J6X


Conserved Protein Domain Family
FMN_dh

?
pfam01070: FMN_dh 
Click on image for an interactive view with Cn3D
FMN-dependent dehydrogenase
Statistics
?
Aligned: 177 rows
Threshold Bit Score: 143.441
Threshold Setting Gi: 189494834
Created: 24-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6BFG_A            16 QKRLPK--MVYDYLEGGAEDEYGVKHNRDVFQQWRFKPKRLVDVSRR--SLQAEVLGKRQSMPLLIGPT--GLNGALw-P 88  Pseudomonas...
jgi:Cphamn1_0417   4 SKTITVn-RKQSHVETCLKRNVCFDTKTTGFERYEFTHNAAPEINHSdiDLATSFLGHRISYPFMISSMtgGYEQAEn-- 80  Chlorobium ...
jgi:Dred_1257     30 SGEVPG--------MGGTGTGVSFRNNLNALASYNLNMRTLHNAKNP--STETELFGVALTSPIMAAPMtgTPYNMGg-S 98  Desulfotoma...
jgi:Cphy_2255     34 RNQIPG--------PGAKGIGDTAIRNYDKWKEIRLNMDTLVAASNI--DTKRTIYGKEFAYPFFAGPV--GAISLHy-G 100 Lachnoclost...
jgi:Clos_1159     30 KGQVPG--------VGGKGSGSSFIRNWQKIQDVKINLDTIIEESPI--DTSIELFGQKFTYPVFAAPI--GAVGLNysP 97  Alkaliphilu...
O29451            67 RQILQErdVNIEVLEGGTERGLTVRRNREILDSIGIKMNLLSDFEP---SLETEFLGRKISMPVMPAPLs-GLVKSVd-A 141 Archaeoglob...
Q0UI74           122 KAVLPH--KSYVYVSTSANTGLSLQCNLDDWGRVSFRPRVMRNVGDV--DTRRKIFGHESPYPFYISPM--GTMGAIh-P 194 Parastagono...
Q2TXM6            54 RRYMNA--SSYTYYRNGAAGEWSYRNNLEAYGRFRFKPRMLVDVTNIesTLPTTILGHNFSAPFYISPC--ARGGLAh-P 128 Aspergillus...
Q0CVD1             8 DKGIA---FNFPVFQSGAEDEFTVRWNKDSWRTIRFRPRVLRPIRSI--DLTTSILGTEYSVPFFICPA--GGGKLAh-P 79  Aspergillus...
Q2U134            88 SQVLAP--RSFAFFKPGANDEYTAQWNQE-----------------R---------GSKLTHPS---------------- 123 Aspergillus...
6BFG_A            89 K--GDLA----LA-RAATKAGI--PF----VLSTASNMSIEDL--------ARqc----dgDLWFQLYVI--H-REIAQG 140 Pseudomonas...
jgi:Cphamn1_0417  81 ---LNRI----LA-QTAEKLGI--PL----GVGSM-RQALENA------------------SFRESFSVV--RqSAPSVP 125 Chlorobium ...
jgi:Dred_1257     99 LseKEFIsmivSGsKQAGTLGWtgDG----ADPEMYNSGLEAI--------TN--------EQGYGIPIIkpReQNVIIE 158 Desulfotoma...
jgi:Cphy_2255    101 DsyNDLTynevLV-KACADAGIa-AF----TGDGVNPEVMKAA--------TDc------iKLVDGVGVP--TvKPWNLN 158 Lachnoclost...
jgi:Clos_1159     98 Al-DDFEytkaII-GGCKEAGVi-GFtgdgVKDEFYDLPLQVV--------KEnn-----gHGIPTIKPW--KkEEIIAK 159 Alkaliphilu...
O29451           142 NcfKRII-------REAWEAGV--VP----WIGHPIQDDVSEF--------EK--------EFVWIIKPL--RnTKRVYD 190 Archaeoglob...
Q0UI74           195 N--GEPE----MY-KGALRKGI--HA----VVSTASSKSTEQImqafmeaqKKmsa--sptKLFFQYYMP--VdRKKAME 257 Parastagono...
Q2TXM6           129 E--AEKN----FV-KAAYEEDI--LY----IPSLYASLSVEEI--------AAakpsngsqTIFQQVYLT--EnDTETKQ 185 Aspergillus...
Q0CVD1            80 T--GEVL----LT-QAAGKHGV--LH----WVCNMAGCSQKQI--------ADarg--paqTLYWQIYAM--NdLSVTEK 134 Aspergillus...
Q2U134           124 ---GDLA----LT-QAAGKHDI--LD----WVPNNSGCTQKQL--------ANara--vsqTLYWQIYAM--EdLSVTEN 177 Aspergillus...
6BFG_A           141 MVLKALHT--GYTTLVLTTDVAVNGYRE--RDLHNrfkIPMSysAKV--VLDGCLHPRWSLDFVrhgmpqlanfvssqtS 214 Pseudomonas...
jgi:Cphamn1_0417 126 VLANIGAPeiAQGLTKKELDTLIDIVRA--DALIVh--LNPA---------QELFQPEGNTRFK---------------- 176 Chlorobium ...
jgi:Dred_1257    159 CIGRAERA--GAKAVGVDIDGAGLV------------------------TMALKGQPVGPKSKR---------------- 196 Desulfotoma...
jgi:Cphy_2255    159 TIKEKSQLikDCNAFAVAMDVDAAGl----------------------pFLKNMQPPAGRKSVE---------------- 200 Lachnoclost...
jgi:Clos_1159    160 -IKKAEEN--GAPAVAMDIDAAGLV------------------------TLALLGKPVGTKSIE---------------- 196 Alkaliphilu...
O29451           191 DVEKAESS----KAMAIGMDIDSAAgi----------kVGGT-------ILSYGGTKVWSKK------------------ 231 Archaeoglob...
Q0UI74           258 LLRIVKRC--DYKGLWITVDAPVLGKRTadRYLQAeemLSMG--------LAEEATAEWETSGD---------------N 312 Parastagono...
Q2TXM6           186 LFEKVEKL--GSKAIVFTVDSAADGNRH--RAARYg-----------------vGSADSSYTYI---------------- 228 Aspergillus...
Q0CVD1           135 EIKQAIAL--GYRGFALTVDAIWSGKRE--RDLRLs--VDGG--DDSdvDQDEEANDGFASGPT---------------- 190 Aspergillus...
Q2U134           178 EIKQAIAL--GYRAFALTVDAPRAGKRE--RDVRLt--IE---------VCKCVTCASVVRTAL---------------- 226 Aspergillus...
6BFG_A           215 SLEMQA--ALMSRqmdASFNWE-A-LRWLRDLWPHKLLVKGL---LSAEDADRCIAEGADGVILSNHGG----------- 276 Pseudomonas...
jgi:Cphamn1_0417 177 -------------------NFLtQ-LKKITETLKVPVIVKEVgcgISPETAKNLVEKGVTIIDIAGAGGiswqkveeery 236 Chlorobium ...
jgi:Dred_1257    197 -----------------------E-IKELVNATKLPFILKGI---MTVDEAEMAVEAGVSAIVVSNHGG----------- 238 Desulfotoma...
jgi:Cphy_2255    201 -------------------ELR-EiIQQINR----PFIVKGV---MTVKGAEKAFEAGASGILVSNHGG----------- 242 Lachnoclost...
jgi:Clos_1159    197 -----------------------D-LKEIISSTKLPVILKGV---MTVEGAKKALKAGAYGIVVSNHGG----------- 238 Alkaliphilu...
O29451           232 -----------------------E-LADLASTTKLPFIVKGV---LSERDYYSLADIS-SAIVVSNHGG----------- 272 Archaeoglob...
Q0UI74           313 KFAPAMggRMVQGqlsPYMSWE-D-LAWIRKEWDGSIVLKGI---QCAEDAKLAMEHGCDGILLSNHGG----------- 376 Parastagono...
Q2TXM6           229 -------------------TWD-Y-YKKLQNMTSLPVVLKGI---QSVEDVKLAVAHGAPAVILSNHGG----------- 273 Aspergillus...
Q0CVD1           191 --------VKRSPi-wTEFDWPsS-IAWLRKITNLPIAIKGI---QSWEDAVLCMEYGVHP-WLSNHGG----------- 245 Aspergillus...
Q2U134           227 --------QCLGMk--------iT-VLPVARRSRGP--IKCI---QSWEDAVLCMEHGVHP-WLSNHGG----------- 272 Aspergillus...
6BFG_A           277 -----RQLDCAISPMEVL-----AQS-----VAKTG--K------PVLIDSGFRRGSDIVKALALGAEAVLLGRATLYGL 333 Pseudomonas...
jgi:Cphamn1_0417 237 lqqfqHENRFSPSALEELlnwgiPTArsltgVAALKsnNthyrhiQIIASGGISNGVDIAKAIALGADLCASAGQM---L 313 Chlorobium ...
jgi:Dred_1257    239 -----RILDFTPGAADVL-----PAI-----AAAVK--Gk----vTILADGGVRTGVDVLKLLALGADGVLVGRPLVVGA 297 Desulfotoma...
jgi:Cphy_2255    243 -----RVLDQCPSTAEVL-----EEI-----AKEFK--Gk----mTIFVDGGIRSGADLFKSLALGADAAIIARPFVTAV 301 Lachnoclost...
jgi:Clos_1159    239 -----RVLDHTPATIEVL-----PAI-----ADAVK--Gr----mKIFVDGGFRTGLDIFKAIALGADAVLIGRPYAVAA 297 Alkaliphilu...
O29451           273 -----RVLDSAISPLELL-----PYL------EKVv---------PTGVDSGFRYGSDVFKALALGADFVLFGRLMVYAL 327 Archaeoglob...
Q0UI74           377 -----RQLHTAPSALMTL-----CEI-----RTYCP--Evmn-klEIFLDGGLRNGNDVLKALCLGATAVGVGRPFLYAL 438 Parastagono...
Q2TXM6           274 -----RQLDGTPSPLEIA-----LEI-----HEEAP--Elfe-qiEIYADGGIRYGADVLKLLALGVTAVGLGRPFMFA- 334 Aspergillus...
Q0CVD1           246 -----RQLEGAPSAVDTL-----LAI-----RKHCP--Qvfd-rcEVIVDGGITRGADIVKALALGARAVGLGRGFLYA- 306 Aspergillus...
Q2U134           273 -----RE------SSEVF-----------------Rr-------cEVIVDGGICRGADIVN---------------HYS- 301 Aspergillus...
6BFG_A           334 AARGETGVDEVLTLLKADIDRTLAQIGCPDITSLSPDYLQ 373 Pseudomonas putida
jgi:Cphamn1_0417 314 KALHEQRLEETILTWMNDLKAVMFLTGTKDIRQLQQTSIS 353 Chlorobium phaeobacteroides BS1
jgi:Dred_1257    298 FGGHTEGVKFLIEKMTSELKQAMILTGCNTIKEINDSVIY 337 Desulfotomaculum reducens MI-1
jgi:Cphy_2255    302 FGGGYEGVRSYIQKIGAELIDVMEMCGVSSLDEITSECIW 341 Lachnoclostridium phytofermentans ISDg
jgi:Clos_1159    298 YGGGAEGVKVYTEKIGNELKETMIMAGCHNLADIKRDRVF 337 Alkaliphilus oremlandii OhILAs
O29451           328 AI--ENGVQTALNMIRDELLRIMKLTGAKSVKEISKEAVV 365 Archaeoglobus fulgidus
Q0UI74           439 GAYGSKGVEKCVDVLAKELRTGMRLLGITSLEQCRPEMVN 478 Parastagonospora nodorum SN15
Q2TXM6           335 NTYGVEGVKHAIQLLKHEIAIDAGNLGVGDLKKLDAS-YE 373 Aspergillus oryzae
Q0CVD1           307 LAFGERGVSRAIRILRHEVETTMALLGVTNLGQLNPSYVD 346 Aspergillus terreus NIH2624
Q2U134           302 -------------------------------------NIY 304 Aspergillus oryzae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap