6FAH,5OL2,3IH5


Conserved Protein Domain Family
ETF

?
pfam01012: ETF 
Click on image for an interactive view with Cn3D
Electron transfer flavoprotein domain
This family includes the homologous domain shared between the alpha and beta subunits of the electron transfer flavoprotein.
Statistics
?
Aligned: 132 rows
Threshold Bit Score: 49.8979
Threshold Setting Gi: 119671709
Created: 24-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6FAH_A                              71 VWVFAEQR-EGKIMPVVFELLGEGKKLANE-Ig-TELCAILCGSNVAE---LTD-ELFaYGADKVYLADAPELEkyTTDG 143 Acetobacterium woodii DSM 1030...
jgi:Mmwyl1_2722                    105 IMVVADMV-GGRLTGHDKDILGLAHKLVA--KqnGAVTLVCFGE-------NKEtQCDlAGVDRLIHLEGDEYDgfAPEA 174 Marinomonas sp. MWYL1...
jgi:Anae109_2896                     4 VLLLTHTDpDGGLPRAALEALSAARAVg---------GPLVIGLFGGavdaAAA-ALGgAGATKLLAVEGPAFAdpRYGT 73  Anaeromyxobacter sp. Fw109-5...
Q0B090                               4 IWIFAEDY------EHNLELIQGGKELAQ--KlaGKIVVILPHNsg---ndEKAhDCIaRGADEVLYLPPLAKDedFMAC 72  Syntrophomonas wolfei subsp. wolfei str. Goettingen G311...
Q24PF0                               7 VWVLAEKQ------AALGQLCAGGRQLGE------EVSAILWGEk-----eEAD-QAIrMGADKVYRLGVPRPEn-LKED 67  Desulfitobacterium hafniense Y51...
jgi:Dred_0573                        6 VFVITDNQ------NAVAELCSGARQLGD------QVSVVLFGDk-----nQAA-EAIaLGADQVYLFGQSGDSv-MIEA 66  Desulfotomaculum reducens MI-1...
WP_013304658                         3 VLVYTESDn-GKFKKNAFEVASYASEV-AKqLg-SSVTAIS----FNSt--eNE-SLGkYGVSKVLNVSNEQLNtfNAKA 72  Maribacter sp. HTCC2170...
CAL42448                             3 ILIYAESAe-GKFKKVAFELASYAKKI-AEtTg-QTVTAIT----VNMn--dVS-ELSnYGIDKVLKVTNDKLAnfTAKA 72  Flavobacterium psychrophilum JIP02/86...
Q11VD4                               3 VLIYVESNg-SEIKKSSMDAVAYGTQV-ASkLg-GSAIVVAIGN-IPQe--qLT-ALGnFGASKVLHVTGDAFNqnAPLA 75  Cytophaga hutchinsonii ATCC 33406...
WGS:AAXU:1101174000282_ALPR1_10950   3 VLVYIEQSe-GKIKKTSLEAVSFAHAL-ASkTgeGDVVAVALGT-IEQg--eLA-AVGsAGAAKVLHSSEEKLNagVIQA 76  Algoriphagus machipongonensis...
6FAH_A                             144 YSKIINEAIGLYKPEIVLYGATHI-GRDLAPCLAVKVNTGLTADCTKLEIdpdD-KK-IRQTRPAFGgnLMaTIVCPgSR 220 Acetobacterium woodii DSM 1030...
jgi:Mmwyl1_2722                    175 RLTALQEIEAQYKPVHWLFPDSVHgGTDLACRLSARLGERLAAQAWQVNAe--Q-----TVCRGASAshDIlR-----DT 242 Marinomonas sp. MWYL1...
jgi:Anae109_2896                    74 DAAAAAALARASGATVVVAPATSR-MARIAAGVAQRLGGRVDTHVTQLSA---E-Gg-LAATRWFYKqrIEaRLRRK-ER 146 Anaeromyxobacter sp. Fw109-5...
Q0B090                              73 IPLIVAEVLQEK-PDIFLIGSSLR-GKELAARIAARLNTGLCSDCISLELs--NdDQsLVMERLIFGgaAVqRVVIP-TR 147 Syntrophomonas wolfei subsp. wolfei str. Goettingen G311...
Q24PF0                              68 YVETIQKLLQEEKPDALFVQPTKR-GKLIAGRLAAGLGTSALVDAVEILT---DgDKv-QIQHMVYGgaAFrTERIQ-PQ 141 Desulfitobacterium hafniense Y51...
jgi:Dred_0573                       67 YSKSIAELLHAEKADLVMVYSSVR-GKLIAGRIASQLGTSALSNISEFTV---EdGSi-IVKHMVYGgaAIrTEKAL-SD 140 Desulfotomaculum reducens MI-1...
WP_013304658                        73 FANAITEAASKESASVIVVSSSSD-TKYLAPIIAAKLSAGYVSNVVAAPE---S-TSpFTVKRSAFSnkGFaHTQIN-TD 146 Maribacter sp. HTCC2170...
CAL42448                            73 YADTIKQAAQKENAKLILLSSSTD-SLYLAPLVSVSLEAGFASNVVGLPT---N-MSpFQVKRTAFSnkAFnITQIN-TD 146 Flavobacterium psychrophilum JIP02/86...
Q11VD4                              76 SAAAVVEAAKKAGAKVIVLPKSTL-VDSFAPKLASQLKAGVVTNVTELPD---T-SAgFQVKRSIFTgkAFaTVSIN-TD 149 Cytophaga hutchinsonii ATCC 33406...
WGS:AAXU:1101174000282_ALPR1_10950  77 HASAVAQAFTQVGAKTLVLAKSSL-GDAVAARLAIKLNAGLVSNVVALPS---T-ESgYLVKRSIFTgkAFaETEVT-TE 150 Algoriphagus machipongonensis...
6FAH_A                             221 PQMSTVRPGVMDKAAYDPSQKGEVIKLDAT 250 Acetobacterium woodii DSM 1030
jgi:Mmwyl1_2722                    243 PRILTLLEECGDA---IDETRHQVLPISVD 269 Marinomonas sp. MWYL1
jgi:Anae109_2896                   147 PWVLLVDPGAYPAAALERGVAPPVEKLAVI 176 Anaeromyxobacter sp. Fw109-5
Q0B090                             148 PQMATIPPRLFSPAAVQEGRTGNIRELPPA 177 Syntrophomonas wolfei subsp. wolfei str. Go...
Q24PF0                             142 TAIVTIGTGVFTPLAEDSGRQGTVIEVEFV 171 Desulfitobacterium hafniense Y51
jgi:Dred_0573                      141 TVVVTVGTGVFEAMSKDATRQGKVIEVNPD 170 Desulfotomaculum reducens MI-1
WP_013304658                       147 TKVIGVSNNSFGAVENNTTA--SVEDFNPS 174 Maribacter sp. HTCC2170
CAL42448                           147 IKVLCLSKNSYGIFENTGAA--TAEDFAPT 174 Flavobacterium psychrophilum JIP02/86
Q11VD4                             150 IKVITLAKNAYQGTETGGTA--AVEALSVS 177 Cytophaga hutchinsonii ATCC 33406
WGS:AAXU:1101174000282_ALPR1_10950 151 NKVLAVKKNSVDLKTDGGDA--AVENFDVA 178 Algoriphagus machipongonensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap