Conserved Protein Domain Family
Synaptobrevin

?
pfam00957: Synaptobrevin 
Synaptobrevin
Statistics
?
PSSM-Id: 334327
View PSSM: pfam00957
Aligned: 96 rows
Threshold Bit Score: 57.162
Threshold Setting Gi: 74843051
Created: 15-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q4SWN4         3 SKRIFLQPKDEVDEVEDKTPSNGKKPLESDQDLSEQDEQSEASQAIAFNFESRAGEQRRRDWWRNMgvpeKIWGTLIYVI 82  spotted green p...
Q26586       123 GNGSLDQLRSNVNTVTAVMQENTRLALQRGDRLNNLVSKTDELAASANQFQTTATKVARKTWWENF----RMKLIIVGVV 198 Schistosoma man...
Q7ZUC1        19 DADRVKALQSQVDGVKDIMTQNVDRILARGERLDDLMGKSEDLEAGAQNFKQTSQKVARAFWWKNV----KLIVLIVVIV 94  zebrafish
Q9BV40         9 GNDRVRNLQSEVEGVKNIMTQNVERILARGENLEHLRNKTEDLEATSEHFKTTSQKVARKFWWKNV----KMIVLICVIV 84  human
Q1HQY2       129 RRRNINTINTQLQDVQRIMVQNIDDVLQRGTVLSELDTKTQNLSMLSQKYKKDATYLNRKSLYVKG--------AVAGIV 200 yellow fever mo...
Q4N5K0       150 SLKSLNMINDSLNEVTNIMKKNIDEILARGENLEDIGRMADGLKQQTLKFRLSSKKLNRNYLIRKF-----SMMAIGILI 224 Theileria parva
Q94AU2       132 TQRNIAKLNDELYEVHQIMTRNVQEVLGVGEKLDQVSEMSSRLTSESRIYADKAKDLNRQALIRKW----APVAIVFGVV 207 thale cress
A0E4K9       137 ADDKIEITCKSVDSIQGLMEENLRKFQMNQEKLHVIHHKSEDISQMANQFQKGATAVNNKQNWAAY----VAIGIFGALV 212 Paramecium tetr...
NP_001243535   4 GNSRLSEAQKDVEEVKGIMLDNLNKAEERSGKLKELETRADDLLVKGKAFSKTATKVKQKKRWENI----KYKVVIAAVA 79  zebrafish
XP_002634893 152 HQQRMIDIRRQVEDVRQVMADNVERIMERGERLENIENRSEALRTSTISFKSTARRVQRHFCQQNL----KWTLILLAVI 227 Caenorhabditis ...
Q4SWN4        83 VIIFIIIMIVSTS 95  spotted green pufferfish
Q26586       199 GGILLVIVIIILW 211 Schistosoma mansoni
Q7ZUC1        95 LVILLIIIFLATG 107 zebrafish
Q9BV40        85 FIIILFIVLFATG 97  human
Q1HQY2       201 IIVFILYF----W 209 yellow fever mosquito
Q4N5K0       225 MVLFLYFVLFKSK 237 Theileria parva
Q94AU2       208 FLLFWVKNKL--W 218 thale cress
A0E4K9       213 IGVIIYLF----L 221 Paramecium tetraurelia
NP_001243535  80 AAVLLGIILAVAL 92  zebrafish
XP_002634893 228 AVIVTAIVLTILH 240 Caenorhabditis briggsae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap