Conserved Protein Domain Family
Orbi_VP5

?
pfam00901: Orbi_VP5 
Orbivirus outer capsid protein VP5
cryoelectron microscopy indicates that VP5 is a trimer implying that there are 360 copies of VP5 per virion.
Statistics
?
PSSM-Id: 279272
View PSSM: pfam00901
Aligned: 2 rows
Threshold Bit Score: 1057.8
Threshold Setting Gi: 139275
Created: 6-Jul-2015
Updated: 5-Aug-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam00901 is a member of the superfamily cl24135.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                      10        20        30        40        50        60        70        80
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 139275   7 SLSRFGKKVGNALTSNTAKKIYSTIGKAAERFAESEIGAATIDGLVQGSVHSIITGESYGESVKQAVLLNVLGTGEELPD 86
gi 139275   7 SLSRFGKKVGNALTSNTAKKIYSTIGKAAERFAESEIGAATIDGLVQGSVHSIITGESYGESVKQAVLLNVLGTGEELPD 86
                      90       100       110       120       130       140       150       160
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 139275  87 PLSPGERGMQTKIKELEDEQRNELVRLKYNKEITEKFGKELGEVYDFMNGEAKEVEAVEEQYTMLCKAVDSYEKILKEED 166
gi 139275  87 PLSPGERGMQTKIKELEDEQRNELVRLKYNKEITEKFGKELGEVYDFMNGEAKEVEAVEEQYTMLCKAVDSYEKILKEED 166
                     170       180       190       200       210       220       230       240
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 139275 167 SKMAILARALQREAAERSEDEIKMVKEYRQKIDALKSAIEIERDGMQEEAIQEIAGMTADVLEAASEEVPLIGAGMATAV 246
gi 139275 167 SKMAILARALQREAAERSEDEIKMVKEYRQKIDALKSAIEIERDGMQEEAIQEIAGMTADVLEAASEEVPLIGAGMATAV 246
                     250       260       270       280       290       300       310       320
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 139275 247 ATGRAIEGAYKLKKVINALSGIDLSHMRSPKIEPTIIATTLEHRFKDIPDEQLAISVLNKKTAVADNCNEIAHIKQEILP 326
gi 139275 247 ATGRAIEGAYKLKKVINALSGIDLSHMRSPKIEPTIIATTLEHRFKDIPDEQLAISVLNKKTAVADNCNEIAHIKQEILP 326
                     330       340       350       360       370       380       390       400
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 139275 327 KFKQIMNEEKEIEGIEDKVIHPRVMMRFKIPRTQQPQIHIYAAPWDSDDVFFFHCVSYHHRNESFFLGFDLGIDVVHFED 406
gi 139275 327 KFKQIMNEEKEIEGIEDKVIHPRVMMRFKIPRTQQPQIHIYAAPWDSDDVFFFHCVSYHHRNESFFLGFDLGIDVVHFED 406
                     410       420       430       440       450       460       470       480
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 139275 407 LTSHWHALGMAQEASGRTLTEAYREFLNLSISSTFSSAIHARRMIRSRAVHPIFLGSMHYDITYEALKNNAQRIVYDDEL 486
gi 139275 407 LTSHWHALGMAQEASGRTLTEAYREFLNLSISSTFSSAIHARRMIRSRAVHPIFLGSMHYDITYEALKNNAQRIVYDDEL 486
                     490       500
              ....*....|....*....|....*..
gi 139275 487 QMHILRGPLHFQRRAILGALKFGVKIL 513
gi 139275 487 QMHILRGPLHFQRRAILGALKFGVKIL 513
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap