4NNJ,1Y8Q,3KYC,1ZFN


Conserved Protein Domain Family
ThiF

?
pfam00899: ThiF 
Click on image for an interactive view with Cn3D
ThiF family
This domain is found in ubiquitin activating E1 family and members of the bacterial ThiF/MoeB/HesA family. It is repeated in Ubiquitin-activating enzyme E1.
Statistics
?
PSSM-Id: 279270
View PSSM: pfam00899
Aligned: 55 rows
Threshold Bit Score: 84.6887
Threshold Setting Gi: 81719608
Created: 12-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4NNJ_A        433 Yd---NQ------Ia--------vFGL-DFQKKIAN-----SKVFLVGSGAIGCEMLKNWAL-LGL-GsgsdgYIVVTDN 487
1Y8Q_A         19 Yd---RQi-----R----------LWGlEAQKRLRA-----SRVLLVGLKGLGAEIAKNLIL-AGV-K-----GLTMLDH 68
gi 74632427    72 La---RS------Rv--------fFGD-DGLEVIRK-----SSVVIVGAGGVGSWAATMLLR-SGV-G-----NVRLVDF 121
gi 2496721    306 Rr---RQvslvrgYrls----sdmLSRlPVASALKS-----KKVVLVGCGAIGSFAAVELAR-SGV-G-----QLTIIDF 366
gi 2496738    292 RrgprRKdtvpsiVpvfrdgeidiGYRvPSVASLRG-----KRIAVVGLGALGSPAAVELAR-NGC-T-----SLHLMDD 359
gi 81568709   315 Fs---RNl-----G----------LVDyAGQRRLLR-----SRVAIAGLGGVGGIHLMTLAR-TGI-G-----NFNLADF 364
gi 81671754    22 deafcRN------Lg--------lISP-TEQQRLRN-----SRVAIAGMGGVGGIDMVALAR-MGI-G-----KFTIADP 74
gi 81719608   104 L----RPdlaslsLv--------aRAPgAGIQRLAArr--sLRVQVRGAGRVGVVLASLLAG-AGV-G-----EVDVQDT 162
gi 2496664    185 Y-----------------------NKTkARDARPVDlpvdlGETHLVGLGAIGHGALWALARqSGLsG-----RLHVVDH 236
gi 521300002   60 Yd---RQ------Ldl------pgFGP-AAQERLRG-----ATVLVAGVGGVGGAAATYLAA-AGV-G-----RLVLVHP 111
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4NNJ_A        488 DSIEKSNLNRQFLFRPKDVGKNKSEVAAEAVCAMNPDLkgKINAKIDKV------------GP-ETeeiF--NDSF---- 548
1Y8Q_A         69 EQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMV--DVKVDTEDI------------EKkPE--------SF---- 122
gi 74632427   122 DQVTLSSLNRHATASRAHVGIPKVESVKQYFSGVVPWA--NIEAVQDLW------------VPaKLsksEqeYTEM---- 183
gi 2496721    367 DLVEPGNTVRWAL-GRSVWGLPKTTALHDFLYHNYPWT--NVGRGHAKV------------GSaISnvdD--VRKLegnp 429
gi 2496738    360 DVVEPGNTIRWEL-GASSWGTKKQDALKRFIEREFPWT--SVLAVPHRIglpncdphipgeTD-R-------LNEL---- 424
gi 81568709   365 DAYSPVNLNRQYGASIASFGRGKLDVMTERALSVNPFL--DIRSFPEGV------------AAeT-------IDAF---- 419
gi 81671754    75 DVFEIRNSNRQYGAMRSTNGQAKAEVMRNIVHDINPEA--EIRAFCEPI------------GK-EN------AATF---- 129
gi 81719608   163 GRVEPWDVAPGGL-PAESIGERRNEAARRAVRSAAPERppRQERASRRT------------TAgAAdpgL--SLVI---- 223
gi 2496664    237 EAVELSNLQRYVLAGQAEIGMSKAVLATTALRSTAL----EVEAHPLKW-----------------------AEHV---- 285
gi 521300002  112 GALEEPDLNRQTLMRPEWIGGSRVACAEQTLRAHHPGV--EIVAIDREL------------SQlPE------LGRL---- 167
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4NNJ_A        549 -------WESL--------DF-VTNA----LDN--VDARTYVDRRCV--FYRkpLLEs--GTLGTKGNTQVI--I----- 595
1Y8Q_A        123 -------FTQF--------DA-VCLT----CCS--RDVIVKVDQICH--KNSikFFTg--DVFGYHGYTFANlgEhefve 176
gi 74632427   184 -------AERLiyvngdkpDW-VLDC----IDN--IDAKVDLLHFCK--SRDikVISs--MGAGCKSDFTQVriAdisqt 245
gi 2496721    430 mrwlralIEDA--------DI-VVDT----SAS--TECQGALAYMCRsiGKR--YVLghaTEGAAGGVVARF--Kpgapg 490
gi 2496738    425 -------LDSV--------DL-VVDA----SAA--PGVTYLLGDICR--ERGlsLISvfaSPNLHGGAVVFHhpEsgcpv 480
gi 81568709   420 -------LKDV--------DL-LVDG----IDFfaLDIRRRLFNRAL--ELGipVITa--GPLGYSCALLVFmpGgmnfd 475
gi 81671754   130 -------LEGA--------DV-LVDG----IDAfeIDLRRLLYREAQ--QRGiyALGa--GPLGFSTAWVVF--Dpkgmt 183
gi 81719608   224 -------LTPR--------DGlGIHA----PDP--AAAEPLI-------TSGtpHLYa--GVVEGTGVVGPFv-Lpgesg 272
gi 2496664    286 -------ARRG--------DW-IFDRvgvaLDT--AADRLAVQGAlp------rWIA---NAWTQEHDLGISrhgfddgq 338
gi 521300002  168 -------VAEA--------DV-VVDA----RHN--FPDRYLLNDTCV--AARtpAVVa--AMNATEGNMLVV--Rpgspc 219
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4NNJ_A        596 -----------------------------PRLtesYSSSRDPPEKSIPLCtlrsfpnkidhtiawakslfqgyftdsaen 646
1Y8Q_A        177 ektkva------------kvsqgvedgpdTKRaklDSSETTMVKKKVVFCpvkealevdwssekakaalkrttsdyfllq 244
gi 74632427   246 aedplsk-----------atrvklrklgvYEGipvIFSTEKPGEAKLLPLedsefekkneenettv-------------- 300
gi 2496721    491 cyvcl---------------qqhwsgktlPLPtidSSGTIVPTGCNAPTF------------------------------ 525
gi 2496738    481 cmahane-----------tpegksghipyPNGmndESTLVQPPGCSELTF------------------------------ 519
gi 81568709   476 syfgidddtppmegylrfgmglaprpahlGYMdrrFVSLHDRRGPSLDIA------------------------------ 525
gi 81671754   184 f------------------------------dryfdlSDAMNTVDKFVAFiagiapsathrrsi---------------- 217
gi 81719608   273 cagc----------------ldqgradrdRTWprlVAQWRSGRPRQVQAC------------------------------ 306
gi 2496664    339 aclccmymp---sgkskdehqliaeelgiPETheqVKALLQTNAGVPNDFvvrvatamgvpfeplapfvgqplrsf---- 411
gi 521300002  220 ------------------------lrcvfT---------EGDPSWQPLGFt----------------------------- 237
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4NNJ_A        647 vnmyltqpnfveqtlkqsgdvkgvlesisdslsskphnfedcikwarlefekkfnhdikqllfnfpkdaktsngepfwsg 726
1Y8Q_A        245 vllkfrtdkgrd-------------------------------------------------------------------- 256
gi 74632427       --------------------------------------------------------------------------------
gi 2496721        --------------------------------------------------------------------------------
gi 2496738        --------------------------------------------------------------------------------
gi 81568709       --------------------------------------------------------------------------------
gi 81671754       --------------------------------------------------------------------------------
gi 81719608       --------------------------------------------------------------------------------
gi 2496664        --------------------------------------------------------------------------------
gi 521300002      --------------------------------------------------------------------------------
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4NNJ_A        727 akraptplefdiynndhfhfvvagaslraynygiksddsnskpnvdeyksvidhmiipeftpnanlkiqvndddpdpnan 806
1Y8Q_A            --------------------------------------------------------------------------------
gi 74632427       --------------------------------------------------------------------------------
gi 2496721        --------------------------------------------------------------------------------
gi 2496738        --------------------------------------------------------------------------------
gi 81568709       --------------------------------------------------------------------------------
gi 81671754       --------------------------------------------------------------------------------
gi 81719608       --------------------------------------------------------------------------------
gi 2496664        --------------------------------------------------------------------------------
gi 521300002      --------------------------------------------------------------------------------
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4NNJ_A        807 aangsdeidqlvsslpdpstlagfklepvdfekdddtnhhiefitacsncraqnyfietadrqktkfiagriipaIATT- 885
1Y8Q_A        257 ---------------------------------pssdtyeedselllqirndvldslgispdllpedfvrycfseMAPV- 302
gi 74632427   301 -----------------------------------------------------------gelsvlpqyrvrilpvLGSL- 320
gi 2496721    526 ---------------------------------------------------------------------------TGGAf 530
gi 2496738    520 ---------------------------------------------------------------------------TGASf 524
gi 81568709       --------------------------------------------------------------------------------
gi 81671754   218 -------------------------------------------------------------dlsyvdienrtgpsVGLA- 235
gi 81719608   307 ---------------------------------------------------------------------------DVAL- 310
gi 2496664    412 --------------------------------------------------yqqaicgglvfqlsdgsrlvrtvvpMAFQ- 440
gi 521300002  238 --------------------------------------------------------------------------vLGAV- 242
                         570       580       590       600       610       620       630
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
4NNJ_A        886 -TSLVTGLVNLELYKLI----DNKTDIEQYKNGFVNLALP------FFGFSEPIASPKGeyn-----nkKYDK 942
1Y8Q_A        303 -CAVVGGILAQEIVKAL----SQRDPPHNNFF--------------FFDGMKGNGIV------------ECLG 344
gi 74632427   321 -PAIFGLSMATHVLTSIgdyaSIPEYIVTQSRHKPKAYDQ------IQQTLVGQLARESkr------rtGENG 380
gi 2496721    531 dLQEVSMEVVRSTIGLL----------APDVYDSGDWQLS------ILDLTENGRRILPrwkaetiaphSSCS 587
gi 2496738    525 dLKELSLETVRMAVDVL----SSPDEWTVSEVRTVNLHNVkrrmppSWRIDPLERHPDC----------GCRS 583
gi 81568709   526 -CHLCAGMAATEAVRILl---HRRGIRPVPYFRQFDPLTG------RHVRGRLRKGLRSplqrlklaiaRRFF 588
gi 81671754   236 -CHLASGVVAAEVLKILl--gHGRV-YAAPYFHQFDAYRS------IYVRKRLRCGNrhplqrvkrrllaryi 298
gi 81719608   311 -ATAVAGVAAGHALAFL----DGELPSSAGARWETSVPRL------DWHARPVWAHPAC----------SCGA 362
gi 2496664    441 -SALAGIMLAAELVKH-----SAGFPMSPTTSTRVNLLRP------LGSHLHDPKAKDSs--------gRCIC 493
gi 521300002  243 -SGMVGCLAATEAIKII----SGFGEPAAGRLLQFDLWDL------DFQVLRARRDPHCptcggpsgsgqrpg 304
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap