5V7Q,3J3V


Conserved Protein Domain Family
Ribosomal_L18p

?
pfam00861: Ribosomal_L18p 
Click on image for an interactive view with Cn3D
Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
This family includes the large subunit ribosomal proteins from bacteria, archaea, the mitochondria and the chloroplast. It does not include the 60S L18 or L5 proteins from Metazoa.
Statistics
?
PSSM-Id: 395691
View PSSM: pfam00861
Aligned: 15 rows
Threshold Bit Score: 118.619
Threshold Setting Gi: 1172979
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5V7Q_O     7 ATRRISRLRRHTRLRKKLS--GTAERPRLVVHRSARHIHVQLVNDLNGTTVAAASSIEADVR--GVPGDKKARSVRVGQL 82  Mycobacterium tuber...
P0CD85     6 YKKTSGKARRALRVRKALK--GCSLKPRLSVVKTNKHVYVQLIDDVEGKTLASISTLAKVAKtsGLTRKNQDNAKALGIK 83  Chlamydia trachomat...
O51447     5 KEAEQRKLRRKKRIKDKIGr-GVASRPRITVFKSNRYFYAQVIDDSKGHTIASISTIEKSLN----LGKNIDDVKKLGEV 79  Borreliella burgdor...
P73305     3 STRKSATQRRHRRLRRHLS--GTSERPRLAVFRSNDHIYAQVIDDVAQHTLAAASTLDPDLKksLSSTATQEASAEVGKL 80  Synechocystis sp. P...
Q31L22     3 VSRRESTRRRHRRVRRTIV--GTPARPRLSVFRSNNHIYAQVIDDAAGHTLAAASSLDPDLRqsLTSGGNQQASAAVGKL 80  Synechococcus elong...
Q5L3S3     5 VDRNAVRKKRHARIRKKIF--GTAERPRLSVFRSNKHIYAQIIDDTKSSTIVSASTLDKEFG--LDSTNNIEAAKKVGEL 80  Geobacillus kaustop...
Q6MSP1     3 FTKAEARKRRHFRVRQKVV--GTAERPRLNVFKSNTNFYAQIIDDTKGVTLVSASTLKMDLK----SKSNTLAAQKVAEE 76  Mycoplasma mycoides...
3J3V_O     5 TSKNAARLKRHARVRAKLS--GTAERPRLNVFRSNKHIYAQIIDDVNGVTLASASTLDKDLN--VESTGDTSAATKVGEL 80  Bacillus subtilis s...
Q50302     2 KTRTEQRRLRHKRIVKKIRatNHDNRVVLMVIKSLNHISVQAWDFSQNIVLASSSSLALKLK-----NGNKDNAKLVGQD 76  Mycoplasma pneumoni...
OXX61597   1 MDKKASRIRRATRARRKIAelGAT---RLVVHRTPRHVYAQVIASNGSEVIAAASTVEKAIRelVKNTGNVDAAKAVGKA 77  Vibrio sp. V15_P4S5...
5V7Q_O    83 IAERAKAAGIDTVVFDRGGYTYGGRIAALADAARENGLSF 122 Mycobacterium tuberculosis
P0CD85    84 IAELGKGLQVDRVVFDRGAHKYHGVVAMVADGAREGGLQF 123 Chlamydia trachomatis D/UW-3/CX
O51447    80 LAKRLKEKNINNLIFDRNGYKYHGLIASFATSLREFGINI 119 Borreliella burgdorferi B31
P73305    81 VAQRAIAKGINQVVFDRGGKLYHGRVKALAEAAREAGLNF 120 Synechocystis sp. PCC 6803 substr. Kazusa
Q31L22    81 IAERAQAKGVTTVVFDRGGNLYHGRVKALAEAAREAGLEF 120 Synechococcus elongatus PCC 7942 = FACHB-805
Q5L3S3    81 VAKRALEKGIKKVVFDRGGYLYHGRVKALADAAREAGLEF 120 Geobacillus kaustophilus HTA426
Q6MSP1    77 IAKKALAANITQVVFDRNGYLYHGKIKAFAETARENGLKF 116 Mycoplasma mycoides subsp. mycoides SC str. PG1
3J3V_O    81 VAKRAAEKGISDVVFDRGGYLYHGRVKALADAAREAGLKF 120 Bacillus subtilis subsp. subtilis str. 168
Q50302    77 IADKLVKLKLTNVVFDTGGSKYHGRIAALAEAARERGLNF 116 Mycoplasma pneumoniae M129
OXX61597  78 IAERALEKGVSAVAFDRSGFQYHGRVAALAESAREAGLKF 117 Vibrio sp. V15_P4S5T153
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap