Conserved Protein Domain Family
Peptidase_C6

?
pfam00851: Peptidase_C6 
Helper component proteinase
This protein is found in genome polyproteins of potyviruses.
Statistics
?
PSSM-Id: 279223
View PSSM: pfam00851
Aligned: 3 rows
Threshold Bit Score: 614.31
Threshold Setting Gi: 81984821
Created: 12-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 410516893  299 ARMRYPSDHTCVAGLPVEDCGRVAAl-------------MAHSILPCYKITCPTCAQQYASLPVSDLFKLLHKHARDGln 365
gi 81984821   757 RASRLKADHEPYESSNNELIGRLAR--------------LVAAVIPKGHLYCKTCCLRVIKSKRADIVNALSKAKQRG-- 820
gi 81983955   267 APYCQPSHHT---------FGHMCRvtwsdteilqfremLSQAIMPQRDPRCDICAEVAGQRTKDEILQHARTSQMMQml 337
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 410516893  366 rlgaDKDRFIHVNkfLIALEHLTEPVDLNLELFNeifksigeKQQAPFKNLNVlnnfflkgkentahEWQVAQLSLLELA 445
gi 81984821   821 ----ERDEFIYDE--LIKLFELQAPPPYKIATIT--------SDDDMFAHIRI--------------GWKPYSGRLSLIM 872
gi 81983955   338 efgkEDERWKAPRrvMETLLEESNWPSMDYSTSSeitticcgNNDEPFRRIYSimkvlaepnladvsAWQEANSSLLQLA 417
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 410516893  446 RFQKNRTDNIkkgdiSFFRNKLSAKANwnly---------lscDNQLDK----NANFLWGQREYHAKRFFSNFFEEIDPA 512
gi 81984821   873 QHLQGLHTSI-----SMLHQSLAGAQN----------------DQQIDRqalhNQVRILHQRNEEHMPFLKKAVDEIQLL 931
gi 81983955   418 RYMKNREMSVqagnsATFTNPFPPTVHtfgptnngadilqgpwDN-------------WGDKQPIALAFFEKHFNKWQ-I 483
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 410516893  513 KGYSA-YEIRKHPSGTRKLSIGNLVVPL---DLAEF--------------RQKMKGDYRKQ------------------- 555
gi 81984821   932 NATDQvANARELYLDTRATSTGDFDILRkyqSIYEFfpnimsrankvgmaVIKSETSLSKAfalmdnaksmnaihtlige 1011
gi 81983955   484 NEFSIdRRVRKHIRGTRKLALMDLNQSRsikDLEDH--------------VQEEEIPYERK------------------- 530
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 410516893  556 ---PGVSKKCTsSKDGNYVYPCCCTTLDDGSAIESTFyPPTKKHLVIGNSGDQKFVDLPKGDSEMLYIAKQGYCYINVfL 632
gi 81984821  1012 dviDNTSGACL-MKNDKTFFSIGCKQGVDGSKMYGPL-CPTKQHVRIHRVESNMQIPLPTFHDATVWEFNEGYCYANQ-L 1088
gi 81983955   531 ------TESCItMYKDQYLYSCSCVTARDGKPYLSMRyLQATGLIPIARGADVQHMPNSDSWQGFYYVAPEGYCYINIfL 604
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 410516893  633 AMLINISEEDAKDFTK-----KVRDMCVPKLGTWPTMMDLATTCAQMRIFYPDVHDAELPRILVDHDTQTCHVVDSFGSQ 707
gi 81984821  1089 AIMVGFINEDEMEFYK-----NQMNQIVLNLGAWPTFEQYLVELRAISLDYPKVRGCPAAIHLVSHANKLIHVLGQFGTI 1163
gi 81983955   605 PMLA------LAPYYKvgklsELIGKLIKVLGKWPKLKDVALACLYITEYHTYAQNALLPPILVHHSTRTMHVVDTLGSL 678
                         490       500       510
                  ....*....|....*....|....*....|...
gi 410516893  708 TTGYHILKASSVSQLILFANDELESDIKHYRVG 740
gi 81984821  1164 NQGWHALEVATVGELVDLCHKKVEGEMLTYKVG 1196
gi 81983955   679 SVGYHVLKAGTVKHLVNLASRLATGEMLDYNVG 711
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap